Product: IL17A Antibody
Catalog: DF6127
Description: Rabbit polyclonal antibody to IL17A
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 18kDa; 18kD(Calculated).
Uniprot: Q16552
RRID: AB_2838094

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:200-1:1500, IHC 1:50-1:200, IF/ICC 1:20-1:50
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(88%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
IL17A Antibody detects endogenous levels of total IL17A.
RRID:
AB_2838094
Cite Format: Affinity Biosciences Cat# DF6127, RRID:AB_2838094.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CTLA 8; CTLA-8; CTLA8; Cytotoxic T lymphocyte associated antigen 8; Cytotoxic T lymphocyte associated protein 8; Cytotoxic T lymphocyte associated serine esterase 8; Cytotoxic T-lymphocyte-associated antigen 8; IL 17A; IL-17; IL-17A; IL17; IL17_HUMAN; Il17a; Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); Interleukin 17A; Interleukin-17A; Interleukin17; Interleukin17A; OTTHUMP00000016597; OTTMUSP00000046003;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q16552 IL17_HUMAN:

Restricted to activated memory T-cells.

Description:
IL-17A is a cystine-linked homodimeric pro-inflammatory cytokine produced by Th17 cells, a distinct CD4+ T cell lineage (1,2). IL-17A stimulates the production of the pro-inflammatory cytokines IL-1β, TNF-α, and IL-6. IL-17A also induces production of the neutrophil chemoattractants IL-8, CXCL1, and CXCL6 thereby bridging adaptive and innate immunity (1,2). IL-17A is intimately involved in mucosal immunity against bacterial infections (1,3) and has a putative role in some autoimmune disorders (1,4). IL-17A effects appear to be exerted primarily through binding to the IL-17RA (5). IL-17A binding induces production of cytokines, chemokines and other proteins through activation of the Erk1/2 MAP kinase, PI3K/Akt, p38, and NF-κB pathways (3,4, 6). Phosphorylation of some Jaks and Stats has been observed.
Sequence:
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Pig
88
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q16552 As Substrate

Site PTM Type Enzyme
T26 Phosphorylation
S36 Phosphorylation

Research Backgrounds

Function:

Ligand for IL17RA and IL17RC. The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC. Involved in inducing stromal cells to produce proinflammatory and hematopoietic cytokines.

PTMs:

Found both in glycosylated and nonglycosylated forms.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Restricted to activated memory T-cells.

Subunit Structure:

Homodimer. Heterodimer with IL17F.

Family&Domains:

Belongs to the IL-17 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

References

1). Week-long normoglycaemia in diabetic mice and minipigs via a subcutaneous dose of a glucose-responsive insulin complex. Nature biomedical engineering, 2023 (PubMed: 38057427) [IF=28.1]

2). α-Synuclein induces Th17 differentiation and impairs the function and stability of Tregs by promoting RORC transcription in Parkinson's disease. Brain, Behavior, and Immunity, 2023 (PubMed: 36343753) [IF=15.1]

3). Ultraviolet B radiation-induced JPH203-loaded keratinocyte extracellular vesicles exert etiological interventions for psoriasis therapy. Journal of controlled release : official journal of the Controlled Release Society, 2023 (PubMed: 37666304) [IF=10.8]

4). Glutamine‐based Metabolism Normalization and Oxidative Stress Alleviation by Self‐assembled bilirubin/V9302 Nanoparticles for Psoriasis Treatment. Advanced Healthcare Materials, 2023 (PubMed: 36690435) [IF=10.0]

5). Immune disruption occurs through altered gut microbiome and NOD2 in arsenic induced mice: Correlation with colon cancer markers. Chemosphere, 2020 (PubMed: 31927375) [IF=8.8]

6). Interleukin 17A deficiency alleviates fluoride-induced testicular injury by inhibiting the immune response and apoptosis. Chemosphere, 2021 (PubMed: 33297146) [IF=8.8]

Application: WB    Species: Mice    Sample: testes

Fig. 6. F can stimulate downstream proteins in IL-17A signal pathway in the testes (n ¼ 13. Three times repetition). Statistical analysis was carried out using one-way ANOVA with Dunnett’s test. Error bars denote the mean ± s.e.m. *P < 0.05, **P < 0.01.

7). Dihydroberberine, an isoquinoline alkaloid, exhibits protective effect against dextran sulfate sodium-induced ulcerative colitis in mice. PHYTOMEDICINE, 2021 (PubMed: 34253428) [IF=7.9]

8). In Vivo Inhibition of MicroRNA-326 in a NOD. H-2h4 Mouse Model of Autoimmune Thyroiditis. Frontiers in Immunology, 2021 (PubMed: 34140947) [IF=7.3]

Application: IF/ICC    Species: Mouse    Sample: thyroid

FIGURE 4 | The counts of Th17 cells were decreased in the LV-sponge groups, while Treg cells were increased.(D) Immunofluorescence staining of CD4+ IL-17+ cells in sections of the thyroid. The CD4+ IL-17+ cells are shown in orange (CD4+, red; IL-17+, green). Under highpower (HP) microscope, three view fields of thyroid section were randomly selected to count the number of CD4+ IL-17+ cells. Scale bar, 50 mm.

9). Apigenin ameliorates imiquimod-induced psoriasis in C57BL/6J mice by inactivating STAT3 and NF-κB. Food Science and Human Wellness, 2024 [IF=7.0]

10). Altered Distribution and Expression of Syndecan-1 and -4 as an Additional Hallmark in Psoriasis. International Journal of Molecular Sciences, 2022 (PubMed: 35742957) [IF=5.6]

Application: IHC    Species: Human    Sample: skin

Figure 5. Effects of anti-TNFα and anti-IL-17α topical treatments onto the Phenion full-thickness skin model. H and E and immunohistological analysis of TNFα and IL17α blockers—treated SEs demonstrate reduction of epidermal thickness, accelerated differentiation process and altered syndecan-1 and -4 expression/distribution. (a) Epidermal thickness was assessed at regular intervals across the sections using ImageJ. (b) Mean epidermal thickness in microns. Three images corresponding to three independent experiments were analyzed per condition. Mean ± SD, t-student test for the comparison of two groups or multiple t-tests for more, * p < 0.05, **** p < 0.0001. (c) The biocompatibility was assayed using MTT proliferation analysis against control which was application of gelatin patch without blockers. (d) Contact sensitivity was assayed by analyzing IL-18 quantity (pg/mL) in the culture supernatant by ELISA at the same experimental conditions. (e) Evaluation of biological factors—enhanced gelatin patches using full-thickness reconstructed skin models. Immunohistological detection of syndecan-1 and -4 in reconstructed skin models after application of gelatin patches containing anti-TNFα or anti-IL17α.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.