SMNDC1 Antibody - #DF6121
Product: | SMNDC1 Antibody |
Catalog: | DF6121 |
Description: | Rabbit polyclonal antibody to SMNDC1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 27kDa; 27kD(Calculated). |
Uniprot: | O75940 |
RRID: | AB_2838088 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6121, RRID:AB_2838088.
Fold/Unfold
30 kDa splicing factor SMNrp; MGC106917; MGC112663; SMN related protein; SMN-related protein; smndc1; SMNR; SPF30; SPF30_HUMAN; Splicing factor 30, survival of motor neuron-related; Survival motor neuron domain containing 1; Survival motor neuron domain containing protein 1; Survival motor neuron domain-containing protein 1; Survival of motor neuron related splicing factor 30; Survival of motor neuron-related-splicing factor 30;
Immunogens
Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas.
- O75940 SPF30_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75940 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K13 | Ubiquitination | Uniprot | |
K37 | Ubiquitination | Uniprot | |
S51 | Phosphorylation | Uniprot | |
T52 | Phosphorylation | Uniprot | |
T57 | Phosphorylation | Uniprot | |
S63 | Phosphorylation | Uniprot | |
S66 | Phosphorylation | Uniprot | |
T67 | Phosphorylation | Uniprot | |
T70 | Phosphorylation | Uniprot | |
K165 | Ubiquitination | Uniprot | |
R184 | Methylation | Uniprot | |
S201 | Phosphorylation | Uniprot | |
S204 | Phosphorylation | Uniprot | |
T206 | Phosphorylation | Uniprot | |
T213 | Phosphorylation | Uniprot | |
K219 | Acetylation | Uniprot | |
K219 | Ubiquitination | Uniprot | |
T222 | Phosphorylation | Uniprot | |
Y224 | Phosphorylation | Uniprot | |
T227 | Phosphorylation | Uniprot | |
K229 | Ubiquitination | Uniprot |
Research Backgrounds
Necessary for spliceosome assembly. Overexpression causes apoptosis.
Nucleus speckle. Nucleus>Cajal body.
Note: Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies.
Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas.
Associates with spliceosomes. Associates with U4/U5/U6 tri-snRNP and with U2 snRNP.
The Tudor domain mediates association with dimethylarginines, which are common in snRNP proteins.
Belongs to the SMN family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.