PSMG2 Antibody - #DF6120
Product: | PSMG2 Antibody |
Catalog: | DF6120 |
Description: | Rabbit polyclonal antibody to PSMG2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 29kDa; 29kD(Calculated). |
Uniprot: | Q969U7 |
RRID: | AB_2838087 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6120, RRID:AB_2838087.
Fold/Unfold
CD40 ligand activated specific transcript 3; CLAST3; HCCA3; Hepatocellular carcinoma susceptibility protein; Hepatocellular carcinoma-susceptibility protein 3; HSPC260; HsT1707; Likely ortholog of mouse CD40 ligand activated specific transcript 3; MDS003; PAC-2; PAC2; proteasome (prosome, macropain) assembly chaperone 2; Proteasome assembly chaperone 2; psmG2; PSMG2_HUMAN; TNFSF5IP1; Tumor necrosis factor superfamily member 5-induced protein 1;
Immunogens
Widely expressed with highest levels in lung, brain and colon. Moderately expressed in muscle, stomach, spleen and heart. Weakly expressed in small intestine, pancreas and liver. Highly expressed in hepatocellular carcinomas with low levels in surrounding liver tissue.
- Q969U7 PSMG2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q969U7 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K111 | Ubiquitination | Uniprot | |
T137 | Phosphorylation | Uniprot | |
Y141 | Phosphorylation | Uniprot | |
K149 | Ubiquitination | Uniprot | |
K154 | Ubiquitination | Uniprot | |
K156 | Ubiquitination | Uniprot | |
K165 | Ubiquitination | Uniprot | |
K188 | Ubiquitination | Uniprot | |
K246 | Ubiquitination | Uniprot |
Research Backgrounds
Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
Degraded by the proteasome upon completion of 20S proteasome maturation.
Nucleus.
Widely expressed with highest levels in lung, brain and colon. Moderately expressed in muscle, stomach, spleen and heart. Weakly expressed in small intestine, pancreas and liver. Highly expressed in hepatocellular carcinomas with low levels in surrounding liver tissue.
Forms a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer interacts directly with the PSMA5 and PSMA7 proteasome alpha subunits.
Belongs to the PSMG2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.