PSME3 Antibody - #DF6074

(1)   (3)  
Product: PSME3 Antibody
Catalog: DF6074
Description: Rabbit polyclonal antibody to PSME3
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 30kDa; 30kD(Calculated).
Uniprot: P61289
RRID: AB_2838042

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(91%), Xenopus(82%)
Clonality:
Polyclonal
Specificity:
PSME3 Antibody detects endogenous levels of total PSME3.
RRID:
AB_2838042
Cite Format: Affinity Biosciences Cat# DF6074, RRID:AB_2838042.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

11S regulator complex gamma subunit; 11S regulator complex subunit gamma; Activator of multicatalytic protease subunit 3; Ki; Ki antigen; Ki nuclear autoantigen; Ki, PA28 gamma; PA28 gamma; PA28g; PA28gamma; Proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki); Proteasome (prosome, macropain) activator subunit 3; Proteasome activator 28 gamma; Proteasome activator 28 subunit gamma; Proteasome activator complex subunit 3; Proteasome activator subunit 3; PSME3; PSME3_HUMAN; REG GAMMA; REG-gamma;

Immunogens

Immunogen:
Uniprot:

P61289(PSME3_HUMAN) >>Visit HPA database.

Gene(ID):
PSME3(10197)
Description:
The 20S proteasome is the major proteolytic enzyme complex involved in intracellular protein degradation. PA700, PA28, and PA200 are three major protein complexes that function as activators of the 20S proteasome. There are three evolutionarily conserved subunits of PA28: PA28α (PSME1), PA28β (PSME2), and PA28γ (PSME3) (1,2). PA28α and PA28β form a heteroheptameric complex and function by binding to the 20S complex at its opening site(s). The PA28α/β complex is present throughout the cell and participates in MHC class I antigen presentation by promoting the generation of antigenic peptides from foreign proteins (2). PA28γ exists in the form of a homoheptamer and is mainly located in the nucleus. The PA28γ complex exerts its function by binding and guiding specific nuclear target proteins to the 20S proteasome for further degradation (3,4).
Sequence:
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
91
Xenopus
82
Zebrafish
73
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P61289 As Substrate

Site PTM Type Enzyme
A2 Acetylation
K6 Acetylation
K6 Sumoylation
K6 Ubiquitination
K12 Sumoylation
K12 Ubiquitination
K14 Acetylation
K14 Sumoylation
K14 Ubiquitination
S17 Phosphorylation
T23 Phosphorylation
S24 Phosphorylation
K36 Ubiquitination
K37 Ubiquitination
S75 Phosphorylation
Y84 Phosphorylation
K85 Ubiquitination
K86 Ubiquitination
C92 S-Nitrosylation
K100 Ubiquitination
K110 Methylation
K110 Ubiquitination
S111 Phosphorylation
K121 Methylation
K121 Ubiquitination
K132 Ubiquitination
T167 Phosphorylation
S170 Phosphorylation
S174 Phosphorylation
Y175 Phosphorylation
S180 Phosphorylation
K195 Acetylation
K195 Ubiquitination
K212 Methylation
Y214 Phosphorylation
S247 Phosphorylation O96017 (CHEK2)
S248 Phosphorylation
Y254 Phosphorylation

Research Backgrounds

Function:

Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition.

PTMs:

Phosphorylated by MAP3K3 (By similarity). Phosphorylation at Ser-247 promotes its association with CCAR2.

Acetylation at the major site Lys-195 is important for oligomerization and ability to degrade its target substrates. Deacetylated by SIRT1.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Localizes to the cytoplasm during mitosis following nuclear envelope breakdown at this distinct stage of the cell cycle which allows its interaction with MAP3K3 kinase.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homoheptamer; the stability of the heptamer is essential for the specific activation of the trypsine-like subunit and inhibition of the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits of the proteasome. Interacts with p53/TP53 and MDM2. Interacts with MAP3K3 (By similarity). Associates with the proteasome. Interacts with CCAR2. Interacts with PSME3IP1 (via C-terminus); the interaction is direct and promotes the association of PSME3 with the 20S proteasome. Interacts with COIL; the interaction is inhibited by PSME3IP1.

(Microbial infection) Interacts with human cytomegalovirus UL27.

Family&Domains:

The C-terminal sequences affect heptamer stability and proteasome affinity.

Belongs to the PA28 family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Proteasome.

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

References

1). L-leucine dietary supplementation modulates muscle protein degradation and increases pro-inflammatory cytokines in tumour-bearing rats. CYTOKINE, 2017 (PubMed: 28494385) [IF=3.8]

Application: WB    Species: rat    Sample: gastrocnemius muscle tissue

Fig. 3.| Muscle mass-to-body weight ratio (%; A), total muscle protein concentrations (µg/µL; B) and proteasome subunits: 11S (% of arbitrary unity; C), 19S (% of arbitrary unity; D), and 20Sα (subunits 29 kDa and 32 kDa; (% of arbitrary unity; E)) in the gastrocnemius muscle tissue of Wistar rats with or without tumour and leucine nutritional supplementation. Data are plotted as the mean ± SD. Legend: C: Rats fed a normal protein diet; L: Rats fed a leucine-rich diet; W:Rats fed a normal protein diet and inoculated with Walker 256 tumour cells; WL:Rats fed a leucine-rich diet and inoculated with Walker 256 tumour cells. Samples were collected on the 7th, 14th and 21st days after the beginning of the experiment. **Significant differences as a result of tumour effects, two-way ANOVA with Bonferroni testing, n = 6 per group; *Significant difference as a result of leucine modulation of tumour effects, two-way ANOVA with Bonferroni testing, n = 6 per group. P ≤ 0.05.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.