Product: NME1 Antibody
Catalog: DF6062
Description: Rabbit polyclonal antibody to NME1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Rabbit, Dog
Mol.Wt.: 17kDa; 17kD(Calculated).
Uniprot: P15531
RRID: AB_2838031

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(88%), Bovine(88%), Rabbit(88%), Dog(100%)
Clonality:
Polyclonal
Specificity:
NME1 Antibody detects endogenous levels of total NME1.
RRID:
AB_2838031
Cite Format: Affinity Biosciences Cat# DF6062, RRID:AB_2838031.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AWD; AWD, drosophila, homolog of; GAAD; Granzyme A activated DNase; Granzyme A-activated DNase; GZMA activated DNase; Metastasis inhibition factor NM23; NB; NBS; NDK A; NDKA; NDKA_HUMAN; NDP kinase A; NDPK-A; NDPKA; NM23; NM23 long variant, included; nm23-H1; NM23-M1; NM23H1B, included; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-NME2 spliced read-through transcript, included; Non-metastatic cells 1, protein (NM23A) expressed in; Nonmetastatic cells 1, protein expressed in; Nonmetastatic protein 23; Nonmetastatic protein 23, homolog 1; Nucleoside diphosphate kinase A; Tumor metastatic process-associated protein;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P15531 NDKA_HUMAN:

Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation.

Description:
The NDK/NME/NM23 kinase family (encoded by the NME gene family) consists of at least eight distinct proteins that exhibit different cellular localization (1). Members of this group inhibit metastasis in a variety of tumor cell types (2). All NDK/NME/NM23 proteins possess nucleoside diphosphatase kinase (NDK) activity and catalyze the phosphorylation of nucleoside diphosphate to the corresponding nucleoside triphosphate to regulate a diverse array of cellular events (3). At least four classes of NDK biochemical activities have been described, including protein-protein interactions (4-6), regulation of GTP-binding protein function (7-9), DNA-associated activities (10,11), and histidine-dependent protein phosphotransferase activity (12). NDK/NME proteins participate in the regulation of a broad spectrum of cellular responses, including development, differentiation, proliferation, endocytosis, and apoptosis (13). Because of its role in metastasis suppression and oncogenesis, NDKA (NME1/NM23-H1) has been widely studied (14). NDKA (NM23-H1) and NDKB (NM23-H2) are encoded by adjacent NME1 and NME2 genes and share 90% sequence identity. Two serine residues (Ser122 and Ser144) on NDKA/NM23-H1 can be phosphorylated by AMPKα1, but only phosphorylation at Ser122 determines whether NDKA channels ATP to AMPKα1. This regulates AMPKα1 activity towards ACC1, an important regulator of fatty acid metabolism (15). Mutation of NDKB/NM23-H2 at Ser122 (S122P) in melanoma cells results in altered phosphoryl transfer activity (16).
Sequence:
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
100
Pig
88
Bovine
88
Rabbit
88
Chicken
75
Horse
0
Sheep
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P15531 As Substrate

Site PTM Type Enzyme
R6 Methylation
K12 Acetylation
K12 Ubiquitination
R18 Methylation
K26 Acetylation
K26 Ubiquitination
K31 Acetylation
K31 Ubiquitination
K39 Ubiquitination
S44 Phosphorylation P15531 (NME1)
K49 Acetylation
K49 Sumoylation
K49 Ubiquitination
Y52 Phosphorylation
K56 Acetylation
K56 Sumoylation
K56 Ubiquitination
R58 Methylation
K66 Acetylation
K66 Ubiquitination
Y67 Phosphorylation
K85 Acetylation
K85 Ubiquitination
R88 Methylation
T94 Phosphorylation P06493 (CDK1)
S99 Phosphorylation
K100 Acetylation
K100 Methylation
K100 Sumoylation
K100 Ubiquitination
T103 Phosphorylation
H118 Phosphorylation P15531 (NME1)
S120 Phosphorylation P15531 (NME1) , P06493 (CDK1)
S122 Phosphorylation Q13131 (PRKAA1)
S125 Phosphorylation
S144 Phosphorylation Q13131 (PRKAA1)

PTMs - P15531 As Enzyme

Substrate Site Source
P15531 (NME1) S44 Uniprot
P15531-2 (NME1) S69 Uniprot
P15531 (NME1) H118 Uniprot
P15531 (NME1) S120 Uniprot
P15531-1 (NME1) S122 Uniprot
P15531-1 (NME1) S125 Uniprot
P15531-2 (NME1) S145 Uniprot
P15531-2 (NME1) S147 Uniprot
P15531-2 (NME1) S150 Uniprot
Q8IVT5 (KSR1) S406 Uniprot
Q969H4-2 (CNKSR1) S385 Uniprot

Research Backgrounds

Function:

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Cell-cycle dependent nuclear localization which can be induced by interaction with Epstein-barr viral proteins or by degradation of the SET complex by GzmA.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation.

Subunit Structure:

Hexamer of two different chains: A and B (A6, A5B, A4B2, A3B3, A2B4, AB5, B6). Interacts with PRUNE1. Component of the SET complex, composed of at least ANP32A, APEX1, HMGB2, NME1, SET and TREX1. Within this complex, interacts directly with SET. Also interacts with TREX1, but only following translocation to the nucleus.

Family&Domains:

Belongs to the NDK family.

Research Fields

· Metabolism > Nucleotide metabolism > Purine metabolism.

· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.