BID Antibody - #DF6016

(4)   (7)  
Product: BID Antibody
Catalog: DF6016
Description: Rabbit polyclonal antibody to BID
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 22kDa; 22kD(Calculated).
Uniprot: P55957
RRID: AB_2837991

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
BID Antibody detects endogenous levels of total BID.
RRID:
AB_2837991
Cite Format: Affinity Biosciences Cat# DF6016, RRID:AB_2837991.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptic death agonist; Apoptotic death agonist BID; BH3 interacting domain death agonist; BH3 interacting domain death agonist p11; BH3 interacting domain death agonist p13; BH3 interacting domain death agonist p15; BH3-interacting domain death agonist p11; BID; BID isoform ES(1b); BID isoform L(2); BID isoform Si6; BID_HUMAN; Desmocollin type 4; FP497; Human BID coding sequence; MGC15319; MGC42355; p11 BID; p13 BID; p15 BID; p22 BID;

Immunogens

Immunogen:
Uniprot:

P55957(BID_HUMAN) >>Visit HPA database.

Gene(ID):
BID(637)
Expression:
P55957 BID_HUMAN:

Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).

Description:
The BH3 domain-only protein, BID, a death agonist member of the Bcl-2/Bcl-xL family (1), is localized in the cytosolic fraction of cells as an inactive precursor (2,3). Its active form is generated upon proteolytic cleavage by caspase-8 in the Fas signaling pathway. Cleaved BID translocates to mitochondria and induces cytochrome c release and mitochondrial damage (2-5). Thus, BID relays an apoptotic signal from the cell surface to mitochondria. However, the precise molecular mechanism for the translocation of the cleaved BID, and for the subsequent release of cytochrome c during apoptosis, is still unclear.
Sequence:
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

PTMs - P55957 As Substrate

Site PTM Type Enzyme
M1 Acetylation
Y54 Phosphorylation
T59 Phosphorylation P53779 (MAPK10) , P45984 (MAPK9) , P48729 (CSNK1A1) , P19784 (CSNK2A2) , P49674 (CSNK1E) , P67870 (CSNK2B) , P68400 (CSNK2A1) , P45983 (MAPK8)
S64 Phosphorylation P49674 (CSNK1E) , P67870 (CSNK2B) , P19784 (CSNK2A2) , P48729 (CSNK1A1) , P68400 (CSNK2A1)
S65 Phosphorylation
S67 Phosphorylation
S76 Phosphorylation
S78 Phosphorylation Q13315 (ATM) , Q13535 (ATR)
K158 Ubiquitination

Research Backgrounds

Function:

The major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.

PTMs:

TNF-alpha induces a caspase-mediated cleavage of p22 BID into a major p15 and minor p13 and p11 products.

p15 BID is ubiquitinated by ITCH; ubiquitination results in proteasome-dependent degradation.

Subcellular Location:

Cytoplasm. Mitochondrion membrane. Mitochondrion outer membrane.
Note: When uncleaved, it is predominantly cytoplasmic.

Mitochondrion membrane.
Note: Translocates to mitochondria as an integral membrane protein.

Mitochondrion membrane.
Note: Associated with the mitochondrial membrane.

Cytoplasm.

Cytoplasm.

Mitochondrion membrane.
Note: A significant proportion of isoform 2 localizes to mitochondria, it may be cleaved constitutively.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).

Subunit Structure:

Forms heterodimers either with the pro-apoptotic protein BAX or the anti-apoptotic protein Bcl-2 (By similarity). p15 BID interacts with ITCH. Interacts with PLEKHN1.

Family&Domains:

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Research Fields

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cardiovascular diseases > Viral myocarditis.

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

References

1). Akkermansia muciniphila Aspartic Protease Amuc_1434* Inhibits Human Colorectal Cancer LS174T Cell Viability via TRAIL-Mediated Apoptosis Pathway. INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, 2020 (PubMed: 32403433) [IF=5.6]

Application: WB    Species: human    Sample: LS174T cells

Figure 5. | Amuc_1434* mediated the activation of the apoptosis pathway in LS174T cells.(B) Amuc_1434* indirectly affected the expression of proteins in the mitochondrial apoptosis pathway.(a) B-cell lymphoma-2 interacting-domain death agonist (Bid), B-cell lymphoma-2-Associated X Protein(Bax), B-cell lymphoma-2 (Bcl-2), Cytochrome c (CytC), and Endonuclease G (EndoG) proteins of LS174T cells were detected using Western blot analysis after treatment with Amuc_1434* for 24 h.β-actin was used as the loading control.
2). Integrative gene expression analysis and animal model reveal immune- and autophagy-related biomarkers in osteomyelitis. Immunity, inflammation and disease, 2024 (PubMed: 38990187) [IF=3.2]

Application: IHC    Species: Rat    Sample:

Figure 10 RT‐qPCR and immunohistochemistry validation. Following the establishment of rat models of osteomyelitis (OM), total RNA was extracted from the focal bone tissues of the OM group and the sham group. The mRNA expression levels of BID (A), CTSB (B), and HSP90AB1 (C) were measured. Immunohistochemical staining was performed on the fixed tibial tissues to evaluate the protein expression levels of BID (D), CTSB (E), and HSP90AB1 (F), with the microscopic positivity rate serving as the measurement index. ns: p ≥ .05, no significant difference; *p 
3). Ferulic acid ameliorates pentylenetetrazol-induced seizures by reducing neuron cell death. EPILEPSY RESEARCH, 2019 (PubMed: 31404716) [IF=2.2]

Application: WB    Species: rat    Sample: hippocampus

Fig. 5. |Western blot results showing the effect of FA on Apaf-1, caspase-9, caspase-3, Bcl-2, Bid, Bax, cleaved caspase-3 and cytochrome C expression in the hippocampus of rats with seizures. Western blot results show the expression of all of the measured proteins (A).
4). Mitofusin-2 Triggers Cervical Carcinoma Cell Hela Apoptosis via Mitochondrial Pathway in Mouse Model. CELLULAR PHYSIOLOGY AND BIOCHEMISTRY, 2018 (PubMed: 29587277)

Application: WB    Species: human    Sample: cervicaltumour cells

Fig. 5.| Mfn2 triggered cervical tumour cell apoptosis via the mitochondrial pathway.Western blot (D) and quantitation (E) showed Bax, Bcl2, Bid and p-Bad protein levels in the cervicaltumour cells. The cervicaltumour cells were prepared from total tumour tissue lysates, and analysed by Western blot. GAPDH was used as reference.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.