p15 INK4b Antibody - #AF5486
| Product: | p15 INK4b Antibody |
| Catalog: | AF5486 |
| Description: | Rabbit polyclonal antibody to p15 INK4b |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Rabbit, Dog |
| Mol.Wt.: | 15 kDa; 15kD(Calculated). |
| Uniprot: | P42772 |
| RRID: | AB_2837966 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5486, RRID:AB_2837966.
Fold/Unfold
CDK inhibitory protein; CDK4B Inhibitor; Cdkn2b; CDN2B_HUMAN; Cyclin dependent kinase 4 inhibitor B; Cyclin Dependent Kinase Inhibitor 2B; Cyclin dependent kinase inhibitor 2B p15 inhibits CDK4; Cyclin dependent kinases 4 and 6 binding protein; Cyclin-dependent kinase 4 inhibitor B; INK4B; MTS 2; MTS-2; MTS2; Multiple tumor suppressor 2; Multiple Tumor Supressor 2; OTTHUMP00000021154; OTTHUMP00000021155; p14 CDK inhibitor; p14 INK4b; p14-INK4b; P15; p15 CDK inhibitor; p15 inhibits CDK4; p15 INK4b; p15-INK4b; p15INK4B; TP 15; TP15;
Immunogens
Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines.
- P42772 CDN2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P42772 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| C74 | S-Nitrosylation | Uniprot | |
| R101 | Methylation | Uniprot |
Research Backgrounds
Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
Cytoplasm.
Note: Also found in the nucleus.
Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines.
Heterodimer of CDKN2B with CDK4 or CDK6. Isoform 2 does not interact with CDK4 nor CDK6.
Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Specific types > Small cell lung cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.