Product: COX IV Antibody
Catalog: AF5468
Description: Rabbit polyclonal antibody to COX IV
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 17 kDa; 20kD(Calculated).
Uniprot: P13073
RRID: AB_2837951

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(91%), Zebrafish(82%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(91%), Dog(100%)
Clonality:
Polyclonal
Specificity:
COX IV Antibody detects endogenous levels of total COX IV.
RRID:
AB_2837951
Cite Format: Affinity Biosciences Cat# AF5468, RRID:AB_2837951.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AL024441; COX 4; COX IV 1; COX IV; COX IV-1; Cox4; COX41_HUMAN; Cox4a; COX4B; COX4I1; COX4I2; COX4L2; COXIV; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit 4 isoform 1 mitochondrial; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; Cytochrome C Oxidase subunit IV; Cytochrome c oxidase subunit IV isoform 1; Cytochrome c oxidase subunit IV isoform 2 (lung); Cytochrome c oxydase subunit 4; dJ857M17.2; MGC105470; MGC72016;

Immunogens

Immunogen:

A synthesized peptide derived from human COX IV, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P13073 COX41_HUMAN:

Ubiquitous.

Description:
This antibody makes an effective loading control for mitochondria. COX IV is generally expressed at a consistent high level. However, be aware that many proteins run at the same 16kD size as COX IV - our VDAC1 / Porin antibody makes a good alternative mitochondrial loading control for proteins of this size.
Sequence:
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Pig
91
Rabbit
91
Zebrafish
82
Xenopus
73
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunbit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Subcellular Location:

Mitochondrion inner membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous.

Family&Domains:

Belongs to the cytochrome c oxidase IV family.

Research Fields

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Metabolism > Energy metabolism > Oxidative phosphorylation.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Circulatory system > Cardiac muscle contraction.   (View pathway)

References

1). Phase separation of OPTN initiates mitophagy to orchestrate craniofacial bone mineralization. Autophagy, 2026 (PubMed: 41692957) [IF=14.6]

2). Zinc ions facilitate metabolic bioenergetic recovery post spinal cord injury by activating microglial mitophagy through the STAT3-FOXO3a-SOD2 pathway. Free radical biology & medicine, 2024 (PubMed: 39613048) [IF=7.1]

3). mTOR pathway mediates endoplasmic reticulum stress-induced CD4+ T cell apoptosis in septic mice. APOPTOSIS, 2022 (PubMed: 35759162) [IF=6.1]

Application: WB    Species: Mice    Sample: CD4+ T cells

Fig. 6 Levels of IRE1α-related pro-apoptotic protein caspase-3 and anti-apoptotic protein BCL-2. Expression of pro-apoptotic protein caspase-3 and anti-apoptotic protein BCL-2 (A, B) in CD4+ T cells. Protein expression were determined by western blotting and showed as the relative expression values of COX-IV. COX-IV was used as a loading control to normalize protein levels. Data are shown as Mean ± SD (n = 3). Statistically significant differences were determined by one-way analysis of variance (ANOVA) followed by Dunn’s/Tukey’s test. *P < 0.05, **P < 0.01, ****P < 0.0001

4). Krüppel like factor 7 regulates mitochondrial dynamics balance in myocardial infarction. Communications biology, 2025 (PubMed: 40346382) [IF=5.9]

Application: WB    Species: Mouse    Sample:

Fig. 8: Cardiomyocyte-specific knockdown of Mfn2 or Phb2 aggravates Klf7 KO mice cardiac function and mitochondria injury after myocardial infarction. a Schematic diagram of the strategy for the echocardiography (Echo) and mitochondrial dynamics analysis. 8-week-old male WT and Klf7 KO mice were randomly grouped and then subjected to tail vein injection of AAV9-Mfn2/Phb2 virus to induce Mfn2/Phb2 knockdown. b Infection efficiency upon mouse tail-vein injection of AAV9 for Mfn2 and Phb2 expression in heart cardiomyocytes (CMs) and endothelial cells (ECs) (AAV-NC, n = 5; AAV-Mfn2/Phb2, n = 4). c An illustration of the ventricle’s long-axis image, with the traced area displaying the heart’s wall movement, and the measurement of EF (d), FS (e) in Klf7 KO mice 1 week post-MI (n = 8). f, g TEM was performed to detect the ultrastructure of cardiomyocytes in heart tissues from mice treated with AAV-Mfn2/Phb2 or AAV-NC in WT or Klf7 KO mice after MI surgery. Red arrows indicate fragmented mitochondria. Scale bar, 1 μm (n = 5). h Cell apoptosis of cardiomyocytes in the border zone was determined by flow cytometry (n = 5). The x-axis labeled Comp-FITC-A indicates Annexin V, while the y-axis labeled Comp-PE-A indicates PI. i, j Apoptosis of cardiomyocytes in the border zone was determined by TUNEL staining. Scale bar, 100 μm (n = 4 mice/group, 3 sections/mouse). k The mRNA expression of apoptosis-relevant genes in Klf7 KO mice after MI (n = 5). In all panels, data are depicted as the mean ± SEM. *P 

5). Pim-1 kinase protects the liver from ischemia reperfusion injury by regulating dynamics-related protein 1. iScience, 2024 (PubMed: 39055921) [IF=5.8]

6). The Ca2+/CaMKK2 axis mediates the telbivudine induced upregulation of creatine kinase: Implications for mechanism of antiviral nucleoside analogs' side effect. BIOCHEMICAL PHARMACOLOGY, 2017 (PubMed: 29038020) [IF=5.3]

Application: WB    Species: human    Sample:


7). FGF21 attenuates pulmonary arterial hypertension via downregulation of miR‐130, which targets PPARγ. Journal of Cellular and Molecular Medicine, 2022 (PubMed: 34989130) [IF=5.3]

Application: WB    Species: Mice    Sample:

FIGURE 4 MiR‐130 inhibits hypoxia‐induced PASMC apoptosis by regulating PPARγ expression. (A–C) Western blotting for Bax, Bcl‐2, cleaved caspase‐3, caspase‐3 and apoptosis‐inducing factor (AIF) expression in PASMCs in Nor, Hyp, Hyp+miR‐130 inhibitor and Hyp+miR‐130 inhibitor+siPPARγ groups, β‐actin was used as a loading control (n = 4). (D‐F) The expression levels of cytochrome c (Cyt C) in mitochondrial and cytosol pellets in PASMCs were examined by western blotting with antibodies against Cyt C with COX IV as a mitochondria marker and β‐actin as the internal control (n = 4). (G) The apoptosis index of PASMCs in each group was measured by TUNEL assay (n = 10) (×200; scale bars indicate 100 µm) and is shown as the ratio of TUNEL positive cells (red) to total cells (blue). Data are presented as the mean ± SD. *p < 0.05, **p < 0.01

8). Zinc defends against Parthanatos and promotes functional recovery after spinal cord injury through SIRT3-mediated anti-oxidative stress and mitophagy. CNS neuroscience & therapeutics, 2023 (PubMed: 37063066) [IF=4.8]

Application: WB    Species: Mouse    Sample:

FIGURE 1. Zinc can inhibit Parthanatos in the spinal cord of SCI mice. (A) Western blot and (B) statistical results of western blots of PARP‐1 (n = 5, one‐way ANOVA followed by Bonferroni's post hoc test). (C) Immunofluorescence and (D) statistical analysis of immunofluorescence staining of PARP‐1 in nerve cells from each group (Scale bar = 50 μm, n = 3, one‐way ANOVA followed by Games–Howell post hoc test). (E) Mitochondrial membrane potential was measured with the JC‐1 probe (n = 5, one‐way ANOVA followed by Bonferroni's post hoc test). (F, H, J) Western blot and (G, I, K) statistical results of western blots of Mito‐AIF, Cyto‐AIF, and Nucleo‐AIF (n = 5, one‐way ANOVA followed by Bonferroni's post hoc test). The data represent means ± SD, * means, p 

9). 2,3,5,4'-Tetrahydroxystilbene-2-O-beta-D-glucopyranoside promotes skin flap survival by promoting mitophagy through the PINK1/Parkin pathway. Journal of ethnopharmacology, 2025 (PubMed: 40043825) [IF=4.8]

10). PRG4 mitigates hemorrhagic shock-induced cardiac injury by inhibiting mitochondrial dysregulation, oxidative stress and NLRP3-mediated pyroptosis. International immunopharmacology, 2024 (PubMed: 38897120) [IF=4.8]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.