COX IV Antibody - #AF5468

Product: | COX IV Antibody |
Catalog: | AF5468 |
Description: | Rabbit polyclonal antibody to COX IV |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 17 kDa; 20kD(Calculated). |
Uniprot: | P13073 |
RRID: | AB_2837951 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5468, RRID:AB_2837951.
Fold/Unfold
AL024441; COX 4; COX IV 1; COX IV; COX IV-1; Cox4; COX41_HUMAN; Cox4a; COX4B; COX4I1; COX4I2; COX4L2; COXIV; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit 4 isoform 1 mitochondrial; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; Cytochrome C Oxidase subunit IV; Cytochrome c oxidase subunit IV isoform 1; Cytochrome c oxidase subunit IV isoform 2 (lung); Cytochrome c oxydase subunit 4; dJ857M17.2; MGC105470; MGC72016;
Immunogens
- P13073 COX41_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P13073 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K12 | Methylation | Uniprot | |
S26 | Phosphorylation | Uniprot | |
K29 | Ubiquitination | Uniprot | |
S30 | Phosphorylation | Uniprot | |
S34 | Phosphorylation | Uniprot | |
Y38 | Phosphorylation | Uniprot | |
K53 | Acetylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
S58 | Phosphorylation | Uniprot | |
K60 | Acetylation | Uniprot | |
K60 | Ubiquitination | Uniprot | |
K63 | Methylation | Uniprot | |
K67 | Acetylation | Uniprot | |
S72 | Phosphorylation | Uniprot | |
S74 | Phosphorylation | Uniprot | |
K87 | Acetylation | Uniprot | |
K87 | Ubiquitination | Uniprot | |
S89 | Phosphorylation | Uniprot | |
Y124 | Phosphorylation | Uniprot | |
S132 | Phosphorylation | Uniprot | |
K135 | Acetylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
K140 | Ubiquitination | Uniprot | |
K149 | Ubiquitination | Uniprot | |
S158 | Phosphorylation | Uniprot | |
K159 | Ubiquitination | Uniprot | |
K164 | Acetylation | Uniprot | |
K164 | Ubiquitination | Uniprot | |
K168 | Acetylation | Uniprot |
Research Backgrounds
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunbit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Mitochondrion inner membrane>Single-pass membrane protein.
Ubiquitous.
Component of the cytochrome c oxidase (complex IV, CIV), a multisubunit enzyme composed of 14 subunits. The complex is composed of a catalytic core of 3 subunits MT-CO1, MT-CO2 and MT-CO3, encoded in the mitochondrial DNA, and 11 supernumerary subunits COX4I1 (or COX4I2), COX5A, COX5B, COX6A1 (or COX6A2), COX6B1 (or COX6B2), COX6C, COX7A2 (or COX7A1), COX7B, COX7C, COX8A and NDUFA4, which are encoded in the nuclear genome. The complex exists as a monomer or a dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with NADH-ubiquinone oxidoreductase (complex I, CI) and ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), resulting in different assemblies (supercomplex SCI(1)III(2)IV(1) and megacomplex MCI(2)III(2)IV(2)). Interacts with AFG1L. Interacts with PHB2; the interaction decreases in absence of SPHK2 (By similarity).
Belongs to the cytochrome c oxidase IV family.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Circulatory system > Cardiac muscle contraction. (View pathway)
References
Application: WB Species: Mice Sample: CD4+ T cells
Application: WB Species: Mice Sample:
Application: WB Species: Mice Sample: liver tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.