GLUT3 Antibody - #AF5463
Product: | GLUT3 Antibody |
Catalog: | AF5463 |
Description: | Rabbit polyclonal antibody to GLUT3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse, Chicken |
Mol.Wt.: | 54 kDa; 54kD(Calculated). |
Uniprot: | P11169 |
RRID: | AB_2837947 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5463, RRID:AB_2837947.
Fold/Unfold
brain; FLJ90380; Glucose transporter type 3; Glucose transporter type 3 brain; GLUT 3; GLUT-3; GLUT3; GTR3_HUMAN; Slc2a3; Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 3; Solute carrier family 2, facilitated glucose transporter member 3;
Immunogens
- P11169 GTR3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P11169 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K223 | Ubiquitination | Uniprot | |
T232 | Phosphorylation | Uniprot | |
K243 | Ubiquitination | Uniprot | |
S250 | Phosphorylation | Uniprot | |
K253 | Ubiquitination | Uniprot | |
T333 | Phosphorylation | Uniprot | |
S352 | Phosphorylation | Uniprot | |
K477 | Ubiquitination | Uniprot | |
S485 | Phosphorylation | Uniprot | |
K490 | Ubiquitination | Uniprot |
Research Backgrounds
Facilitative glucose transporter that can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport.
Cell membrane>Multi-pass membrane protein. Perikaryon. Cell projection.
Note: Localized to densely spaced patches along neuronal processes.
Highly expressed in brain. Expressed in many tissues.
Transport is mediated via a series of conformation changes, switching between a conformation where the substrate-binding cavity is accessible from the outside, and a another conformation where it is accessible from the cytoplasm.
Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
References
Application: WB Species: Mice Sample: hippocampal homogenates
Application: WB Species: Mice Sample: cerebral cortex
Application: WB Species: mouse Sample: hippocampus
Application: WB Species: Mice Sample: GC cells
Application: IF/ICC Species: Mice Sample: PC12 Neurons
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.