Phospho-Cyclin C (Ser275) Antibody - #AF5435
Product: | Phospho-Cyclin C (Ser275) Antibody |
Catalog: | AF5435 |
Description: | Rabbit polyclonal antibody to Phospho-Cyclin C (Ser275) |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 33 kDa; 33kD(Calculated). |
Uniprot: | P24863 |
RRID: | AB_2837919 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5435, RRID:AB_2837919.
Fold/Unfold
ccnc; CCNC_HUMAN; CycC; Cyclin C; Cyclin-C; hSRB11; OTTHUMP00000016897; SRB11 homolog;
Immunogens
Highest levels in pancreas. High levels in heart, liver, skeletal muscle and kidney. Low levels in brain.
- P24863 CCNC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P24863 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K30 | Ubiquitination | Uniprot | |
S33 | Phosphorylation | Uniprot | |
Y73 | Phosphorylation | Uniprot | |
S104 | Phosphorylation | Uniprot | |
K117 | Ubiquitination | Uniprot | |
S121 | Phosphorylation | Uniprot | |
Y122 | Phosphorylation | Uniprot | |
K126 | Ubiquitination | Uniprot | |
K248 | Ubiquitination | Uniprot | |
T252 | Phosphorylation | Uniprot | |
S275 | Phosphorylation | Uniprot | |
S278 | Phosphorylation | Uniprot | |
S279 | Phosphorylation | Uniprot | |
Y280 | Phosphorylation | Uniprot | |
S281 | Phosphorylation | Uniprot | |
S283 | Phosphorylation | Uniprot |
Research Backgrounds
Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Binds to and activates cyclin-dependent kinase CDK8 that phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex.
Nucleus.
Highest levels in pancreas. High levels in heart, liver, skeletal muscle and kidney. Low levels in brain.
Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. The cylin/CDK pair formed by CCNC/CDK8 also associates with the large subunit of RNA polymerase II.
Belongs to the cyclin family. Cyclin C subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.