Phospho-Caveolin 2 (Tyr27) Antibody - #AF5429
Product: | Phospho-Caveolin 2 (Tyr27) Antibody |
Catalog: | AF5429 |
Description: | Rabbit polyclonal antibody to Phospho-Caveolin 2 (Tyr27) |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 27 kDa; 18kD(Calculated). |
Uniprot: | P51636 |
RRID: | AB_2837913 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5429, RRID:AB_2837913.
Fold/Unfold
CAV; CAV2; CAV2_HUMAN; Caveolae protein 20 kD; Caveolin 2; Caveolin 2 isoform a and b; Caveolin-2; MGC12294; OTTHUMP00000025032; OTTHUMP00000195982;
Immunogens
Expressed in endothelial cells, smooth muscle cells, skeletal myoblasts and fibroblasts.
- P51636 CAV2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD
PTMs - P51636 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K7 | Ubiquitination | Uniprot | |
S18 | Phosphorylation | Uniprot | |
Y19 | Phosphorylation | P12931 (SRC) | Uniprot |
S20 | Phosphorylation | Uniprot | |
S23 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
Y27 | Phosphorylation | P12931 (SRC) | Uniprot |
S36 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
K50 | Ubiquitination | Uniprot | |
T121 | Phosphorylation | Uniprot | |
S128 | Phosphorylation | Uniprot | |
T131 | Phosphorylation | Uniprot | |
S135 | Phosphorylation | Uniprot |
Research Backgrounds
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).
Phosphorylated on serine and tyrosine residues. CAV1 promotes phosphorylation on Ser-23 which then targets the complex to the plasma membrane, lipid rafts and caveolae. Phosphorylation on Ser-36 appears to modulate mitosis in endothelial cells (By similarity). Phosphorylation on both Tyr-19 and Tyr-27 is required for insulin-induced 'Ser-727' phosphorylation of STAT3 and its activation. Phosphorylation on Tyr-19 is required for insulin-induced phosphorylation of MAPK1 and DNA binding of STAT3. Tyrosine phosphorylation is induced by both EGF and insulin (By similarity).
Nucleus. Cytoplasm. Golgi apparatus membrane>Peripheral membrane protein. Cell membrane>Peripheral membrane protein. Membrane>Caveola>Peripheral membrane protein.
Note: Potential hairpin-like structure in the membrane. Membrane protein of caveolae. Tyr-19-phosphorylated form is enriched at sites of cell-cell contact and is translocated to the nucleus in complex with MAPK1 in response to insulin (By similarity). Tyr-27-phosphorylated form is located both in the cytoplasm and plasma membrane. CAV1-mediated Ser-23-phosphorylated form locates to the plasma membrane. Ser-36-phosphorylated form resides in intracellular compartments.
Expressed in endothelial cells, smooth muscle cells, skeletal myoblasts and fibroblasts.
Monomer or homodimer. Interacts with CAV1; the interaction forms a stable heterooligomeric complex that is required for targeting to lipid rafts and for caveolae formation. Tyrosine phosphorylated forms do not form heterooligomers with the Tyr-19-phosphorylated form existing as a monomer or dimer, and the Tyr-27-form as a monomer only. Interacts (tyrosine phosphorylated form) with the SH2 domain-containing proteins, RASA1, NCK1 and SRC. Interacts (tyrosine phosphorylated form) with INSR, the interaction (Tyr-27-phosphorylated form) is increased on insulin stimulation. Interacts (Tyr-19 phosphorylated form) with MAPK1 (phosphorylated form); the interaction, promoted by insulin, leads to nuclear location and MAPK1 activation. Interacts with STAT3; the interaction is increased on insulin-induced tyrosine phosphorylation leading to STAT activation (By similarity).
Belongs to the caveolin family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.