Product: Caspase 1 Antibody
Catalog: AF5418
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Rabbit
Mol.Wt.: 45kD(Pro); 45kD(Calculated).
Uniprot: P29466
RRID: AB_2837902

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(89%), Rabbit(89%)
Clonality:
Polyclonal
Specificity:
Caspase 1 Antibody detects endogenous levels of total Caspase 1.
RRID:
AB_2837902
Cite Format: Affinity Biosciences Cat# AF5418, RRID:AB_2837902.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CASP-1; CASP1; CASP1_HUMAN; Caspase 1; Caspase-1 subunit p10; ICE; IL-1 beta-converting enzyme; IL-1BC; IL1 beta converting enzyme; IL1B convertase; Interleukin 1 beta convertase; Interleukin 1B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P29466 CASP1_HUMAN:

Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.

Description:
Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis.
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
89
Rabbit
89
Horse
78
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P29466 As Substrate

Site PTM Type Enzyme
S16 Phosphorylation
T21 Phosphorylation
T32 Phosphorylation
K37 Ubiquitination
K44 Ubiquitination
T49 Phosphorylation
K53 Ubiquitination
K134 Ubiquitination
K148 Ubiquitination
S149 Phosphorylation
K158 Ubiquitination
K204 Ubiquitination
T226 Phosphorylation
S227 Phosphorylation
K268 Ubiquitination
K274 Ubiquitination
K278 Ubiquitination
S306 Phosphorylation
K319 Ubiquitination
K320 Ubiquitination
K325 Ubiquitination
S376 Phosphorylation

Research Backgrounds

Function:

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.

PTMs:

The two subunits are derived from the precursor sequence by an autocatalytic mechanism.

Subcellular Location:

Cytoplasm. Cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.

Subunit Structure:

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 10 kDa (p10) subunit. The p20 subunit can also form a heterodimer with the epsilon isoform which then has an inhibitory effect. May be a component of the inflammasome, a protein complex which also includes PYCARD, CARD8 and NALP2 and whose function would be the activation of proinflammatory caspases. Both the p10 and p20 subunits interact with MEFV. Interacts with CARD17/INCA and CARD18. Interacts with SERPINB1; this interaction regulates CASP1 activity.

Family&Domains:

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

References

1). Jia X et al. Arsenic induces hepatic insulin resistance via mtROS-NLRP3 inflammasome pathway. J Hazard Mater 2020 Jun 4;399:123034. (PubMed: 32544768) [IF=14.224]

Application: WB    Species: Human    Sample: HepG2 cells

Fig.3 NaAsO2 impairs insulin signaling via activation of NLRP3 inflammasome in HepG2 cells. HepG2 cells were pretreated with 1 μg/ml LPS for 4 hours, 5 μM MCC950, for 4 hours, and were then treated with 4 μM NaAsO2 for 24 hours. Cytosolic fractions were analyzed by Western blot analysis. GAPDH was used as an internal control. The efficiency of MCC950, and its effect on NLRP3, caspase-1 activation, IL-1β and IL- 18 production in NaAsO2-treated HepG2 cells (A-E). HepG2 cells were stimulated with 100 nM insulin for 10 min at the end of treatment. Cytosolic fractions were analyzed by Western blot analysis. GAPDH was used as an internal control. The efficiency of MCC950, and its effect on p-IRS (Ser 307)/IRS1 and p-AKT (Ser473)/AKT1 ratio in NaAsO2-treated HepG2 cells (F-H). Insulin‐ stimulated glucose uptake in HepG2 cells was measured using a glucose assay kit (I). Results are mean ± SEM (n = 3). *P < 0.05 compare with the LPS group. #P<0.05 compare with 4 μM NaAsO2 group.

2). Tao Y et al. Autophagic-CTSB-inflammasome axis modulates hepatic stellate cells activation in arsenic-induced liver fibrosis. Chemosphere 2019 Sep 24;242:124959 (PubMed: 31669990) [IF=8.943]

Application: WB    Species: rat    Sample: livers

Fig.2 |NaAsO2 induced autophagy, activation of NLRP3 inflammasome and hepatic stellate cell in vivo. (A) The expression level of LC3 and p62 in rat liver following exposure to NaAsO2. The protein fraction was analyzed by Western blot. (B)The expression level of cytoplasmic CTSB in rat livers following exposure to NaAsO2.The protein fraction was analyzed by Western blot. (C) The expression level of NLRP3 inflammasome-associated proteins in rat livers following exposure to NaAsO2.The protein fraction was analyzed by Western blot.

Application: WB    Species: rat    Sample: livers

Fig.2 NaAsO2 induced autophagy, activation of NLRP3 inflammasome and 662 hepatic stellate cell in vivo. (A) The expression level of LC3 and p62 in rat livers 663 following exposure to NaAsO2. The protein fraction was analyzed by Western blot. (B) 664 The expression level of cytoplasmic CTSB in rat livers following exposure to NaAsO2. 665 The protein fraction was analyzed by Western blot. (C) The expression level of NLRP3 inflammasome-associated proteins in rat livers following exposure to NaAsO2. 667 The protein fraction was analyzed by Western blot. (D) The expression level of 668 Collagen- , α-SMA, MMP-1, and TIMP-1in rat livers following exposure to NaAsO2. 669 The protein fraction was analyzed by Western blot. (E) α-SMA was detected by IF. 670 White arrows indicate positive staining. Values are mean ± SD, and n = 5. *p < 0.05, 671 **p < 0.01 compared with the control group; Scale bar = 100 µm

3). Xia C et al. Autophagy and Exosome Coordinately Enhance Macrophage M1 Polarization and Recruitment in Influenza A Virus Infection. Front Immunol 2022 Mar 17;13:722053. (PubMed: 35371077) [IF=8.786]

Application: WB    Species: mouse    Sample: macrophages

FIGURE s4 |The total proteins of infected primary peritoneal macrophages were extracted at 24, 36, 48, and 72 h post-infection and then subjected for Western blotting. The corresponding antibodies were used to analyze autophagic protein (LC3, p62), exosome marker (CD63), and IL-1β activation pathway (IL-1β, cleaved IL-1β, and caspase-1) normalized to GAPDH.

4). Liu X et al. Combination of resolvin E1 and lipoxin A4 promotes the resolution of pulpitis by inhibiting NF-κB activation through upregulating sirtuin 7 in dental pulp fibroblasts. Cell Prolif 2022 Apr 11;e13227. (PubMed: 35411569) [IF=8.755]

Application: WB    Species: rat    Sample: Dental pulp fibroblasts

FIGURE 1 |Effects of combined administration of RvE1 and LXA4 on pro-inflammatory factor expression.(C) NLRP3, (D) caspase-1, (E) IL-1β and (F) IL-18 mRNA levels on LPS-induced DPFs detected by qPCR and (G) their protein levels tested by western blotting (normalized to that of β-tubulin).

5). Hong Z et al. The ROS/GRK2/HIF-1α/NLRP3 Pathway Mediates Pyroptosis of Fibroblast-Like Synoviocytes and the Regulation of Monomer Derivatives of Paeoniflorin. Oxid Med Cell Longev 2022 Jan 29;2022:4566851. (PubMed: 35132350) [IF=7.310]

6). Zhan X et al. Polysaccharides from Garlic Protect against Liver Injury in DSS-Induced Inflammatory Bowel Disease of Mice via Suppressing Pyroptosis and Oxidative Damage. Oxid Med Cell Longev 2022 Aug 16;2022:2042163. (PubMed: 36017235) [IF=7.310]

7). Zhao X et al. Quercetin Protects Ethanol-Induced Hepatocyte Pyroptosis via Scavenging Mitochondrial ROS and Promoting PGC-1α-Regulated Mitochondrial Homeostasis in L02 Cells. Oxid Med Cell Longev 2022 Jul 16;2022:4591134. (PubMed: 35879991) [IF=7.310]

8). Cao Z et al. Crosstalk of pyroptosis, ferroptosis, and mitochondrial aldehyde dehydrogenase 2-related mechanisms in sepsis-induced lung injury in a mouse model. Bioengineered 2022 Mar;13(3):4810-4820. (PubMed: 35188436) [IF=6.832]

9). Jiang X et al. MCC950 ameliorates ventricular arrhythmia vulnerability induced by heart failure. Bioengineered 2022 Mar 14. (PubMed: 35287557) [IF=6.832]

10). Lin X et al. Ameliorate effect of pyrroloquinoline quinone against cyclophosphamide-induced nephrotoxicity by activating the Nrf2 pathway and inhibiting the NLRP3 pathway. Life Sci 2020 Jun 3;256:117901. (PubMed: 32504759) [IF=6.780]

Application: WB    Species: mouse    Sample: kidney

Fig. 7. |Effect of PQQ on protein expression in the NLRP3 inflammatory pathway. The expression levels of NLRP3 (A), ASC (B), and Caspase-1 (C). Data are shown as mean ± SD, n = 8. #p < 0.05 and ##p < 0.01 versus the Control group. ⁎p < 0.05 and ⁎⁎p < 0.01 versus the Model group.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.