FRA2 Antibody - #AF5345
Product: | FRA2 Antibody |
Catalog: | AF5345 |
Description: | Rabbit polyclonal antibody to FRA2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | P15408 |
RRID: | AB_2837830 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5345, RRID:AB_2837830.
Fold/Unfold
FLJ23306; Fos L2; FOS like antigen 2; Fos related antigen 2; Fos-related antigen 2; FosL 2; Fosl2; FOSL2_HUMAN; FRA 2; FRA-2;
Immunogens
- P15408 FOSL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15408 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
Y2 | Phosphorylation | Uniprot | |
Y5 | Phosphorylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
S19 | Phosphorylation | Uniprot | |
K35 | Ubiquitination | Uniprot | |
S79 | Phosphorylation | Uniprot | |
S83 | Phosphorylation | Uniprot | |
K104 | Acetylation | Uniprot | |
K104 | Methylation | Uniprot | |
K104 | Ubiquitination | Uniprot | |
S120 | Phosphorylation | Uniprot | |
K151 | Ubiquitination | Uniprot | |
K168 | Ubiquitination | Uniprot | |
S194 | Phosphorylation | Uniprot | |
S200 | Phosphorylation | Uniprot | |
S211 | Phosphorylation | Uniprot | |
S215 | Phosphorylation | Uniprot | |
K222 | Acetylation | Uniprot | |
K222 | Sumoylation | Uniprot | |
S230 | Phosphorylation | Uniprot | |
S232 | Phosphorylation | Uniprot | |
S233 | Phosphorylation | Uniprot | |
S235 | Phosphorylation | Uniprot | |
K240 | Acetylation | Uniprot | |
K240 | Ubiquitination | Uniprot | |
S307 | Phosphorylation | Uniprot | |
S308 | Phosphorylation | Uniprot | |
S309 | Phosphorylation | Uniprot | |
S310 | Phosphorylation | Uniprot | |
S317 | Phosphorylation | Uniprot | |
S320 | Phosphorylation | Uniprot | |
T322 | Phosphorylation | Uniprot |
Research Backgrounds
Controls osteoclast survival and size. As a dimer with JUN, activates LIF transcription. Activates CEBPB transcription in PGE2-activated osteoblasts.
Nucleus.
Heterodimer.
Belongs to the bZIP family. Fos subfamily.
Research Fields
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
References
Application: WB Species: Mouse Sample: kidneys
Application: IHC Species: Mouse Sample: kidneys
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.