INSL3 Antibody - #AF5227
Product: | INSL3 Antibody |
Catalog: | AF5227 |
Description: | Rabbit polyclonal antibody to INSL3 |
Application: | WB |
Reactivity: | Human |
Prediction: | Pig, Dog |
Mol.Wt.: | 14 kDa; 15kD(Calculated). |
Uniprot: | P51460 |
RRID: | AB_2837713 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5227, RRID:AB_2837713.
Fold/Unfold
INSL 3; INSL3; INSL3_HUMAN; Insulin like 3; insulin like peptide, Leydig cell-specific; insulin-like 3 (Leydig cell); Insulin-like 3 A chain; Ley IL; Ley-I-L; leydig insulin -like hormone; Leydig insulin like peptide; Leydig insulin-like peptide; prepro-INSL3; Relaxin like factor; Relaxin-like factor; relaxin-like factor b; RLF; RLNL;
Immunogens
Expressed in prenatal and postnatal Leydig cells. Found as well in the corpus luteum, trophoblast, fetal membranes and breast.
- P51460 INSL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor.
Secreted.
Expressed in prenatal and postnatal Leydig cells. Found as well in the corpus luteum, trophoblast, fetal membranes and breast.
Heterodimer of a B chain and an A chain linked by two disulfide bonds.
Belongs to the insulin family.
Research Fields
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.