GPR120 Antibody - #AF5219
Product: | GPR120 Antibody |
Catalog: | AF5219 |
Description: | Rabbit polyclonal antibody to GPR120 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 42 kDa; 42kD(Calculated). |
Uniprot: | Q5NUL3 |
RRID: | AB_2837705 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5219, RRID:AB_2837705.
Fold/Unfold
G protein coupled receptor 120; G protein coupled receptor 129; G protein coupled receptor GT01; G protein coupled receptor PGR 4; G protein coupled receptor PGR4; G-protein coupled receptor 120; G-protein coupled receptor 129; G-protein coupled receptor GT01; G-protein coupled receptor PGR4; GPR 120; GPR 129; GPR120; GPR129; GT01; HGNC:19345; MGC119984; O3FA1_HUMAN; O3FAR1; Omega-3 fatty acid receptor 1; PGR 4; PGR4;
Immunogens
Abundant expression in the intestinal tract. Highly expressed in adipose tissue, small intestine and pancreas.
- Q5NUL3 FFAR4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q5NUL3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S253 | Phosphorylation | Uniprot | |
T258 | Phosphorylation | Uniprot | |
Y263 | Phosphorylation | Uniprot | |
S266 | Phosphorylation | Uniprot | |
T363 | Phosphorylation | Uniprot | |
S366 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for medium and long-chain free fatty acids (FFAs). Signals via a G(q)/G(11)-coupled pathway. Acts as a receptor for omega-3 fatty acids and mediates robust anti-inflammatory effects, particularly in macrophages and fat cells. The anti-inflammatory effects involve inhibition of TAK1 through a beta-arrestin 2 (ARRB2)/TAB1-dependent effect, but independent of the G(q)/G(11)-coupled pathway. Mediates potent insulin sensitizing and antidiabetic effects by repressing macrophage-induced tissue inflammation. May mediate the taste of fatty acids. Mediates FFA-induced inhibition of apoptosis in enteroendocrine cells. May play a role in the regulation of adipocyte development and differentiation.
Phosphorylated. FFA stimulation facilitates phosphorylation.
Cell membrane>Multi-pass membrane protein.
Note: Colocalized with ARRB2 following DHA treatment.
Abundant expression in the intestinal tract. Highly expressed in adipose tissue, small intestine and pancreas.
Interacts with ARRB2 following docosahexaenoic acid (DHA) stimulation.
Belongs to the G-protein coupled receptor 1 family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.