Claudin 5 Antibody - #AF5216

(24)   (21)  
Product: Claudin 5 Antibody
Catalog: AF5216
Source: Rabbit
Application: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat, Pig, Bovine, Monkey
Prediction: Pig, Bovine, Rabbit, Chicken, Xenopus
Mol.Wt.: 23 kDa; 23kD(Calculated).
Uniprot: O00501
RRID: AB_2837702

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Pig,Bovine,Monkey
Prediction:
Rabbit(93%), Chicken(80%), Xenopus(80%)
Clonality:
Polyclonal
Specificity:
Claudin 5 Antibody detects endogenous levels of total Claudin 5.
RRID:
AB_2837702
Cite Format: Affinity Biosciences Cat# AF5216, RRID:AB_2837702.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Androgen withdrawal and apoptosis induced protein RVP1 like; AWAL; BEC 1; BEC1; Claudin 5 (transmembrane protein deleted in velocardiofacial syndrome); Claudin-5; Claudin5; CLD5_HUMAN; CLDN 5; Cldn5; CPETR L1; CPETRL 1; CPETRL1; TMDVCF; TMVCF; Transmembrane protein deleted in VCFS; Transmembrane protein deleted in velocardiofacial syndrome;

Immunogens

Immunogen:
Uniprot:

O00501(CLD5_HUMAN) >>Visit HPA database.

Gene(ID):
CLDN5(7122)
Description:
Plays a major role in tight junction-specific obliteration of the intercellular space.
Sequence:
MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
93
Rabbit
93
Xenopus
80
Chicken
80
Horse
0
Sheep
0
Dog
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - O00501 As Substrate

Site PTM Type Enzyme
S86 Phosphorylation
Y148 Phosphorylation
S155 Phosphorylation
T207 Phosphorylation
T209 Phosphorylation
Y212 Phosphorylation
Y217 Phosphorylation

Research Backgrounds

Function:

Plays a major role in tight junction-specific obliteration of the intercellular space.

Subcellular Location:

Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Directly interacts with TJP1/ZO-1, TJP2/ZO-2 and TJP3/ZO-3. Interacts with MPDZ (By similarity).

Family&Domains:

Belongs to the claudin family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

References

1). Wang Q et al. Activation of Wnt/β-catenin pathway mitigates blood–brain barrier dysfunction in Alzheimer's disease. Brain 2022 Jul 5;awac236. (PubMed: 35788280) [IF=15.255]
2). Huang Y et al. Stealthy nanoparticles protect endothelial barrier from leakiness by resisting the absorption of VE-cadherin. Nanoscale 2021 Aug 7;13(29):12577-12586. (PubMed: 34259298) [IF=8.307]

Application: WB    Species: Human    Sample: HMVEC cells

Fig. 4 (a) Schematic showing the protein pull down experimental setup. Immunoblotting (left panel) and its semi-quantitative analysis (right panel) of (b) VEC, SOD1, claudin-5 and α-tublin from whole cell lysate and pulled down by different NPs. (c) Y658 (p-VEC(Y658)), Y731 (p-VEC(Y731), VEC and α-tublin from the whole cell lysate with/without the Src kinase inhibitor, PP1.
3). Tang W et al. The lncRNA-AK046375 Upregulates Metallothionein-2 by Sequestering miR-491-5p to Relieve the Brain Oxidative Stress Burden after Traumatic Brain Injury. Oxid Med Cell Longev 2022 Feb 16;2022:8188404. (PubMed: 35222805) [IF=7.310]

Application: WB    Species: Mice    Sample:

Figure 7 AK046375 maintains BBB integrity and decreases brain water content in mice on 7 days after TBI. (a) Western blotting results of ZO1, occludin, and claudin-5 in each group and quantification (n = 6/group, mean ± SD). (b) Brain water content in each group after TBI (n = 6/group, mean ± SD). (c, d) Fluorescence of Evans blue and Evans blue extravasation in each group around the injury site (n = 12/group, mean ± SD) (scale bar = 50 μm, 200x) (∗P < 0.05 vs. the overexpression vector group, &P < 0.05 vs. the knockdown vector group by one-way ANOVA).
4). Liu MB et al. Icariside II attenuates cerebral ischemia/reperfusion-induced blood–brain barrier dysfunction in rats via regulating the balance of MMP9/TIMP1. Acta Pharmacol Sin 2020 Jun 2. (PubMed: 32488170) [IF=7.169]

Application: WB    Species: Rat    Sample: Cerebrum

Fig. 6 ICS II improved BBB integrity after cerebral I/R by upregulating the expression of tight junction-related proteins. a Representative images of immunoblotting staining of claudin 5, occludin and ZO 1 in the penumbra. b Quantitative analysis of occludin. c Quantitative analysis of claudin 5. d Quantitative analysis of ZO 1. *P < 0.05, **P < 0.01 vs sham; #P < 0.05, ##P < 0.01 vs MCAO; n = 6 per group

Application: WB    Species: rat    Sample:

Fig. 6| ICS II improved BBB integrity after cerebral I/R by upregulating the expression of tight junction-related proteins. a Representative images of immunoblotting staining of claudin 5, occludin and ZO 1 in the penumbra.
5). Chen L et al. Electroacupuncture Reduces Oocyte Number and Maintains Vascular Barrier Against Ovarian Hyperstimulation Syndrome by Regulating CD200. Front Cell Dev Biol 2021 Feb 22;9:648578. (PubMed: 33693006) [IF=6.081]

Application: WB    Species: human    Sample: HUVECs

FIGURE 5 | Effects of hCG on CD200 and inflammatory response pathway in KGN cells and the effects of CM on vascular permeability in HUVECs. The cells were treated with vehicle control (Ctrl) and 1, 10, and 100 IU/mL hCG for 24 h. The protein levels of CD200 and CD200R (A), Cyp19a1, IL-1β, and TNFα (B), and of NF-κB, p-NF-κB, p38 MAPK, and p-p38 MAPK (C) were examined. HUVECs were treated with condition culture medium from KGN for 24 h. (D) The levels of vasoactive proteins VEGF and VEGFR2, and cell junction proteins of Occludin, Claudin 5, and ZO-1 in HUVECs.
6). Wei C et al. Resolvin D1 ameliorates Inflammation-Mediated Blood-Brain Barrier Disruption After Subarachnoid Hemorrhage in rats by Modulating A20 and NLRP3 Inflammasome. Front Pharmacol 2021 Feb 3;11:610734. (PubMed: 33732145) [IF=5.810]

Application: WB    Species: Rat    Sample: cerebral cortex vascular tissues

FIGURE 4 The effect of RVD1 on maintenance of blood-brain barrier integrity after SAH. (A) Representative images of ICH staining for MMP-9 in the cerebral cortex vascular tissues after SAH. (B) Representative western blot bands and quantitative analysis of the expression of (C) MMP-9, (D) tight junction-related proteins, (E) claudin-5, (F) occludin, and (G) ZO-1 in the ipsilateral cortex at 24 h post-SAH. Scale bar = 50 μm; *p < 0.05 vs. sham group, # p < 0.05 vs. SAH + vehicle group; n = 6 per group.
7). Zhang L et al. Protective Effects of the Soluble Epoxide Hydrolase Inhibitor 1-Trifluoromethoxyphenyl-3-(1-Propionylpiperidin-4-yl) Urea in a Rat Model of Permanent Middle Cerebral Artery Occlusion. Front Pharmacol 2020 Feb 28;11:182. (PubMed: 32184732) [IF=5.810]

Application: WB    Species: Rat    Sample: brain tissues

Figure 4 1-trifluoromethoxyphenyl-3-(1-propionylpiperidin-4-yl) urea (TPPU) recovered expression of tight junction proteins down-regulated by permanent cerebral middle artery occlusion (pMCAO). (A) Brains were removed from animals at 1 or 3 days after surgery, and cortical tissue was homogenized and assayed by Western blot against Occludin, ZO-1, and Claudin-5. (B) Quantitation of relative levels of ZO-1 (n = 5). (C) Quantitation of Occludin levels (n = 5). (D) Quantitation of relative levels of Claudin-5 (n = 5). Data are the mean ± SEM. **p < 0.01, ***p < 0.001, ****p < 0.0001.
8). Zhu JJ et al. LXA4 protects against hypoxic-ischemic damage in neonatal rats by reducing the inflammatory response via the IκB/NF-κB pathway. Int Immunopharmacol 2020 Oct 20;89(Pt B):107095. (PubMed: 33096360) [IF=5.714]

Application: WB    Species: rat    Sample: brain

Fig. 3. |LXA4 intervention may prevent BBB disruption following HI brain damage in neonatal rats. . (F) Protein expression level of Occludin and Claudin-5, 24 h after HI brain injury.
9). Li C et al. Disruption of Epithelial Barrier of Caco-2 Cell Monolayers by excretory secretory products of Trichinella Spiralis might be Related to serine Protease. Front Microbiol 2021 Mar 17;12:634185. (PubMed: 33815318) [IF=5.640]
10). Xu B et al. Meningitic Escherichia coli-Induced Interleukin-17A Facilitates Blood–Brain Barrier Disruption via Inhibiting Proteinase 3/Protease-Activated Receptor 2 Axis. Front Cell Neurosci 2022 Feb 11;16:814867. (PubMed: 35221923) [IF=5.505]

Application: WB    Species: Human    Sample: hBMECs

FIGURE 3 Interleukin-17A treatment downregulates the expression of TJs and AJs. IF analysis of vascular endothelium integrity in infected WT or IL-17A KO mice. ZO-1 (A), Occludin (B), Claudin-5 (C), and VE-Cadherin (D) were selected as the markers reflecting the integrity of the vascular endothelium. CD31 was applied explicitly for labeling the microvessels. Scale bar indicates 50 μm. (E) The qPCR analysis of ZO-1, Occludin, Claudin-5, and VE-Cadherin transcription in hBMECs treated by multiple dosages of IL-17A (0, 1, 5, 10, and 20 ng/mL). GAPDH was used as the internal reference. Data were presented as mean ± SD from three independent experiments. (F) Western blot analysis of ZO-1, Occludin, Claudin-5, and VE-Cadherin in hBMECs in response to multiple dosages of IL-17A. β-Actin was used as the loading control.
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.