Claudin 6 Antibody - #AF5213

Product: | Claudin 6 Antibody |
Catalog: | AF5213 |
Description: | Rabbit polyclonal antibody to Claudin 6 |
Application: | WB IHC IF/ICC |
Cited expt.: | WB, IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 23 kDa; 23kD(Calculated). |
Uniprot: | P56747 |
RRID: | AB_2837699 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5213, RRID:AB_2837699.
Fold/Unfold
Claudin-6; Claudin6; CLD6_HUMAN; CLDN 6; CLDN6; OTTHUMP00000159248; Skullin 2; Skullin; UNQ757/PRO1488;
Immunogens
A synthesized peptide derived from human Claudin 6, corresponding to a region within the internal amino acids.
Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.
- P56747 CLD6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays a major role in tight junction-specific obliteration of the intercellular space.
(Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.
Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.
Belongs to the claudin family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
References
Application: IF/ICC Species: Human Sample: SMMC-7721 and MHCC-97H cells
Application: WB Species: Human Sample: SMMC-7721 and MHCC-97H cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.