PRLHR Antibody - #AF5212
Product: | PRLHR Antibody |
Catalog: | AF5212 |
Description: | Rabbit polyclonal antibody to PRLHR |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 41 kDa; 41kD(Calculated). |
Uniprot: | P49683 |
RRID: | AB_2837698 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5212, RRID:AB_2837698.
Fold/Unfold
G protein coupled receptor 10; G-protein coupled receptor 10; GPR 10; GPR10; GR 3; GR3; hGR 3; hGR3; MGC126539; MGC126541; OTTHUMP00000020584; PRLH RECEPTOR; PRLHR; PRLHR_HUMAN; Prolactin releasing hormone receptor; Prolactin releasing peptide receptor; Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; uhr-1;
Immunogens
Only detected in the pituitary gland and in all cell types of pituitary adenomas.
- P49683 PRLHR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49683 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S244 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.
Cell membrane>Multi-pass membrane protein.
Only detected in the pituitary gland and in all cell types of pituitary adenomas.
Interacts through its C-terminal region with the PDZ domain-containing proteins GRIP1, GRIP2 and PICK1. Interacts with PDZ domains 4 and 5 of GRIP1 and with the PDZ domain of PICK1.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.