Product: BMP6 Antibody
Catalog: AF5196
Description: Rabbit polyclonal antibody to BMP6
Application: WB IHC
Reactivity: Human
Mol.Wt.: 57 kDa; 57kD(Calculated).
Uniprot: P22004
RRID: AB_2837682

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
BMP6 Antibody detects endogenous levels of total BMP6.
RRID:
AB_2837682
Cite Format: Affinity Biosciences Cat# AF5196, RRID:AB_2837682.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BMP-6; Bmp6; BMP6_HUMAN; Bone morphogenetic protein 6; Bone Morphogenic Protein 6; Decapentaplegic vegetal related; DVR6; HGNC:12686; TGFB related vegetal related growth factor; Transforming growth factor beta; Vegetal related (TGFB related) cytokine; Vegetal related growth factor (TGFB related); Vg related sequence; VG-1-R; VG-1-related protein; Vg1 related sequence; VGR; VGR-1; VGR1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Induces cartilage and bone formation.
Sequence:
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

PTMs - P22004 As Substrate

Site PTM Type Enzyme
S398 O-Glycosylation

Research Backgrounds

Function:

Induces cartilage and bone formation.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with SOSTDC1.

Family&Domains:

Belongs to the TGF-beta family.

Research Fields

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Ovarian steroidogenesis.

References

1). A novel UV-curable extravascular stent to prevent restenosis of venous grafts. Composites Part B: Engineering, 2021 [IF=13.1]

2). TNIK drives castration-resistant prostate cancer via phosphorylating EGFR. iScience, 2024 (PubMed: 38226156) [IF=5.8]

Application: IHC    Species: Mouse    Sample:

Figure 6 Targeting TNIK suppresses CRPC tumor progression in vivo (A) C4-2 cells were implanted subcutaneously in male BALB/c mice. When tumors became palpable, mice administered daily by oral gavage either with vehicle (10% DMSO in PBS) or NCB0846 (80 mg/kg of body weight) for 10 days (n = 4 mice for each treatment). Tumor volumes were measured with calipers. (B) Tumor size of xenografts of the above represented the growth of tumor over 10 days (n = 4) in athymic nude mice (p < 0.001). Data are shown as mean ± SD. (C) Tumor weight of the control mice tumors and NCB-0846-treated mice tumors (p < 0.001). Data are shown as mean ± SD. (D) Body weight of nude mice after implantation of control or C4-2 xenografts and treatment with vehicle or NCB-0846 for 4 weeks. (E) Quantitation of Ki-67, TNIK, p-EGFR, β-catenin, vimentin, E-cadherin, BMP6, and BMP7 expressions in C4-2 xenograft tumors from each group; specimens were got at 10 days posttreatment. Scale bars: 500 μm. The IHC was scored according to number of cells expressing the indicated proteins, and statistical analysis was performed (non-parametric Kruskal-Wallis test) in order to determine significance. Data are shown as mean ± SD.

3). H2O2 induces oxidative stress damage through the BMP‐6/SMAD/hepcidin axis. DEVELOPMENT GROWTH & DIFFERENTIATION, 2020 (PubMed: 32012242) [IF=2.5]

Application: WB    Species: human    Sample: retinal pigment epithelial (RPE) cells

FIGURE 2|Effect of oxidative stress on BMP-6 mRNA and protein levels in retinal pigment epithelial (RPE) cells. (a) Compared with that in the blank control group, the level of BMP-6 mRNA in the H2O2-treated group decreased significantly, *p < .05. (b) Western blot images of BMP-6.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.