Cathepsin B Antibody - #AF5189
![](/images/pubmed.gif)
Product: | Cathepsin B Antibody |
Catalog: | AF5189 |
Description: | Rabbit polyclonal antibody to Cathepsin B |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 37 kDa; 38kD(Calculated). |
Uniprot: | P07858 |
RRID: | AB_2837675 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5189, RRID:AB_2837675.
Fold/Unfold
Amyloid precursor protein secretase; APP secretase; APPS; CATB_HUMAN; Cathepsin B heavy chain; Cathepsin B1; CathepsinB; CPSB; CTSB; cysteine protease; OTTHUMP00000116009; OTTHUMP00000229510; OTTHUMP00000229511; OTTHUMP00000229512; OTTHUMP00000229514; OTTHUMP00000229515; OTTHUMP00000229516; Preprocathepsin B;
Immunogens
Expressed in the stratum spinosum of the epidermis. Weak expression is detected in the stratum granulosum.
- P07858 CATB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
PTMs - P07858 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y33 | Phosphorylation | Uniprot | |
S169 | Phosphorylation | Uniprot | |
Y173 | Phosphorylation | Uniprot | |
N192 | N-Glycosylation | Uniprot | |
C211 | S-Nitrosylation | Uniprot | |
Y215 | Phosphorylation | Uniprot | |
Y219 | Phosphorylation | Uniprot | |
K223 | Ubiquitination | Uniprot | |
K237 | Ubiquitination | Uniprot | |
Y244 | Phosphorylation | Uniprot | |
C319 | S-Nitrosylation | Uniprot |
Research Backgrounds
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen (By similarity). Has also been implicated in tumor invasion and metastasis.
Lysosome. Melanosome. Secreted>Extracellular space. Apical cell membrane>Peripheral membrane protein>Extracellular side.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV (PubMed:17081065). Localizes to the lumen of thyroid follicles and to the apical membrane of thyroid epithelial cells (By similarity).
Expressed in the stratum spinosum of the epidermis. Weak expression is detected in the stratum granulosum.
Dimer of a heavy chain and a light chain cross-linked by a disulfide bond. Interacts with SRPX2. Directly interacts with SHKBP1.
Belongs to the peptidase C1 family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Renin secretion.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.