Product: BMP4 Antibody
Catalog: AF5175
Description: Rabbit polyclonal antibody to BMP4
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 46 kDa(Observed); 47kD(Calculated).
Uniprot: P12644
RRID: AB_2837661

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Bovine(93%), Sheep(%), Rabbit(%), Dog(%)
Clonality:
Polyclonal
Specificity:
BMP4 Antibody detects endogenous levels of total BMP4.
RRID:
AB_2837661
Cite Format: Affinity Biosciences Cat# AF5175, RRID:AB_2837661.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

zgc:100779; BMP 2B; BMP 4; BMP-2B; BMP-4; BMP2B; BMP2B1; BMP4; BMP4_HUMAN; Bone morphogenetic protein 2B; Bone morphogenetic protein 4; DVR4; MCOPS6; MGC100779; OFC11; zbmp-4; ZYME;

Immunogens

Immunogen:

A synthesized peptide derived from human BMP4, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P12644 BMP4_HUMAN:

Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.

Description:
Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction
Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
93
Sheep
93
Dog
93
Rabbit
86
Chicken
71
Pig
0
Horse
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Induces cartilage and bone formation. Also acts in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity).

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.

Family&Domains:

Belongs to the TGF-beta family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.   (View pathway)

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.   (View pathway)

References

1). Biological Behavior of Bioactive Glasses SinGlass (45S5) and SinGlass High (F18) in the Repair of Critical Bone Defects. Biomolecules, 2025 (PubMed: 39858506) [IF=5.5]

Application: IHC    Species: Rat    Sample:

Figure 6. Histological sections (counterstained with Harris hematoxylin) showing immunolabeling in the three experimental groups at 14 and 42 days. Control Group (G1/CG): bone defect filled with a blood clot. SinGlass Group (G2/SG): bone defect filled with approximately 0.010 g of SinGlass 45S5. High SinGlass Group (G3/HSG): bone defect filled with approximately 0.010 g of SinGlass High (F18). Arrowheads indicate sites where brown stain marks the proteins: immunostaining for osteocalcin (OCN), immunostaining for tartrate-resistant acid phosphatase (TRAP), immunostaining for vascular endothelial growth factor (VEGF), immunostaining for bone morphogenetic protein 2 and 4 (BMP 2 and BMP 4). Positive cells’ reaction tissue (RT) and new bone (NB). Scale bars: 200 μm, magnification: 20×.

2). Effect of LncRNA-MALAT1 on mineralization of dental pulp cells in a high-glucose microenvironment. Frontiers in Cell and Developmental Biology, 2022 (PubMed: 36035997) [IF=4.6]

Application: WB    Species: Human    Sample:

FIGURE 2 Effects of a high-glucose microenvironment on mineralization of DPCs. (A,C) NC group 7 /14 days after induced mineralization stained by alizarin red; (B,D) high-glucose group 7 /14 days after induced mineralization stained by alizarin red; (E) semi-quantitative analysis of alizarin red staining; (F) expression of mineralization-related factors was detected by qRT-PCR after 7 days of DPCs which were cultured in a high-glucose microenvironment; (G) expression of mineralization-related factors was detected by qRT-PCR after 14 days; (H) expression results of mineralization-related factors detected by Western blot after 7 /14 days of DPC induction in a high-glucose microenvironment; (I,J) density ratio of target proteins to GAPDH on 7 days and 14 days (n = 3, scale bar = 500 μm # p < 0.05, *p < 0.01).

3). Biofunctional response of a synthetic ceramic of 99.9% tricalcium phosphate associated with a heterologous fibrin biopolymer and infrared photobiomodulation. Frontiers in bioengineering and biotechnology, 2026 (PubMed: 41602461) [IF=4.3]

4). TMF suppresses chondrocyte hypertrophy in osteoarthritic cartilage by mediating the FOXO3a/BMPER pathway. Experimental and therapeutic medicine, 2024 (PubMed: 38800044) [IF=2.4]

Application: WB    Species: Human    Sample: C28/I2 cells

Figure 2 Effects of TMF on chondrocyte hypertrophy in vitro. Protein expression levels of (A and B) Col X, (A and C) Runx2, (A and D) BMPER, (A and E) BMP4 and (A and F) p-Smad1/Smad1. Immunofluorescent intensity of (G) Col X and (H) Runx2. *P

5). Network pharmacology of rhizoma drynariae exosomes: a novel approach to bone regeneration. Cytotechnology, 2025 (PubMed: 41257032) [IF=2.0]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.