Product: NGF Antibody
Catalog: AF5172
Description: Rabbit polyclonal antibody to NGF
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 26 kDa; 27kD(Calculated).
Uniprot: P01138
RRID: AB_2837658

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(91%), Zebrafish(80%), Bovine(91%), Horse(91%), Sheep(91%), Rabbit(100%), Dog(91%)
Clonality:
Polyclonal
Specificity:
NGF Antibody detects endogenous levels of total NGF.
RRID:
AB_2837658
Cite Format: Affinity Biosciences Cat# AF5172, RRID:AB_2837658.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta nerve growth factor; Beta NGF; Beta-nerve growth factor; Beta-NGF; HSAN5; MGC161426; MGC161428; Nerve growth factor (beta polypeptide); Nerve growth factor; Nerve growth factor beta; Nerve growth factor beta polypeptide; Nerve growth factor beta subunit; NGF; NGF_HUMAN; NGFB; NID67;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival.
Sequence:
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Pig
91
Horse
91
Bovine
91
Sheep
91
Dog
91
Zebrafish
80
Xenopus
73
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01138 As Substrate

Site PTM Type Enzyme
S43 O-Glycosylation
T46 O-Glycosylation
S84 Phosphorylation
K155 Acetylation

Research Backgrounds

Function:

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (Probable). The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro) (By similarity). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form (By similarity).

Subcellular Location:

Secreted. Endosome lumen.
Note: ProNGF is endocytosed after binding to the cell surface receptor formed by SORT1 and NGFR.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer. The homodimer interacts with a single NTRK1 chain. The homodimer interacts with a single NGFR chain. The NGF dimer interacts with a single SORCS2 chain (via extracellular domain) (By similarity). The NGF precursor (proNGF) binds to a receptor complex formed by SORT1 and NGFR, which leads to NGF endocytosis. Both mature NGF and the immature NGF precursor (proNGF) interact with SORCS2 and with the heterodimer formed by SORCS2 and NGFR (via extracellular domains) (By similarity). The NGF precursor (proNGF) has much higher affinity for SORCS2 than mature NGF. The NGF precursor (proNGF) has much higher affinity for SORT1 than mature NGF (By similarity). Interacts with ADAM10 in a divalent cation-dependent manner.

Family&Domains:

Belongs to the NGF-beta family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.   (View pathway)

References

1). 3D-bioprinted GelMA nerve guidance conduits promoted peripheral nerve regeneration by inducing trans-differentiation of MSCs into SCLCs via PIEZO1/YAP axis. Materials Today Advances, 2023 [IF=8.1]

Application: WB    Species: Rat    Sample: MSCs

Fig. 4. The correlation between trans-differentiation and PIEZO1/YAP expression in MSCs. (A) Representative immunofluorescent images for the subcellular localization and activating states of YAP/TAZ in MSCs plating on GelMA and hard substrate (HS) before trans-differentiation. Scale bar:100 μm. (B) Representative immunofluorescent images for the activating states of YAP/TAZ and expression of S100β in GelMA and HS groups after trans-differentiation. Scale bar:100 μm. (C) Representative immunofluorescent images for the subcellular localization and activating states of YAP/TAZ and PIEZO1 in MSCs after trans-differentiation. Scale bar:10 μm. (D) Immunoblotted image for PIEZO2, PIEZO1, YAP/TAZ, p-YAP, GFAP, NGF, S100β in MSCs plating on GelMA and HS after co-culture with Ne–4C. (E) Densitometric analysis of blots showing the values of relevant proteins in GelMA and HS groups. (F) Immunoblotted image for PIEZO1, YAP/TAZ, p-YAP and GFAP in MSCs in co-culture system, after being treated with Yoda1 and GsMTx4. (G) Densitometric analysis of blots showing the values of relevant proteins in MSCs after being treated with Yoda1 and GsMTx4. (H) An indirect co-culture system including NE-4C in the upper chamber and MSCs plated on GelMA in the lower chambers.

2). MicroRNA‑133b targets TGFβ receptor I to inhibit TGF‑β‑induced epithelial‑to‑mesenchymal transition and metastasis by suppressing the TGF‑β/SMAD pathway in breast cancer. INTERNATIONAL JOURNAL OF ONCOLOGY, 2019 (PubMed: 31545407) [IF=4.5]

Application: WB    Species: human    Sample: MCF‑7 cells

Figure 3. |miR‑133b suppresses TGF‑β‑induced epithelial‑to‑mesenchymal transition and invasion of breast cancer cells. (A) Western blot analysis for the expression of TGFβR1, p‑SMAD3, SMAD3, Snail and N‑cadherin in MCF‑7 cells transfected with miR‑NC or miR‑133b mimics in the absence or presence of TGF‑β1 (5 ng/ml) for 24 h.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.