Product: SDF 1 Antibody
Catalog: AF5166
Description: Rabbit polyclonal antibody to SDF 1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus
Mol.Wt.: 10 kDa; 11kD(Calculated).
Uniprot: P48061
RRID: AB_2837652

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(86%), Horse(100%), Sheep(86%), Dog(100%), Chicken(100%), Xenopus(88%)
Clonality:
Polyclonal
Specificity:
SDF 1 Antibody detects endogenous levels of total SDF 1.
RRID:
AB_2837652
Cite Format: Affinity Biosciences Cat# AF5166, RRID:AB_2837652.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

12-O-tetradecanoylphorbol 13-acetate repressed protein 1; AI174028; C-X-C motif chemokine 12; Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); Chemokine (C-X-C motif) ligand 12; Chemokine CXC motif ligand 12; cxcl12; hIRH; hSDF-1; Intercrine reduced in hepatomas; IRH; OTTHUMP00000019491; PBSF; Pre-B cell growth-stimulating factor; SCYB12; SDF 1; SDF-1; SDF-1-alpha(3-67); SDF-1a; SDF-1b; SDF1_HUMAN; SDF1A; SDF1B; Stromal cell-derived factor 1; Stromal cell-derived factor 1 delta; Stromal cell-derived factor 1 gamma; Stromal cell-derived factor 1a; Stromal cell-derived factor-1 alpha; Thymic lymphoma cell-stimulating factor; Tlsf; TLSF-a; TLSF-b; Tlsfa; Tlsfb; TPAR1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P48061 SDF1_HUMAN:

Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen.

Description:
Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase.
Sequence:
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Dog
100
Chicken
100
Xenopus
88
Bovine
86
Sheep
86
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P48061 As Substrate

Site PTM Type Enzyme
Y28 Phosphorylation
Y82 Phosphorylation

Research Backgrounds

Function:

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).

PTMs:

Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen.

Subunit Structure:

Monomer or homodimer; in equilibrium. Dimer formation is induced by non acidic pH and the presence of multivalent anions, and by binding to CXCR4 or heparin. Monomeric form is required for full chemotactic activity and resistance to ischemia/reperfusion injury, whereas the dimeric form acts as a partial agonist of CXCR4, stimulating Ca2+ mobilization but with no chemotactic activity and instead acts as a selective antagonist that blocks chemotaxis induced by the monomeric form. Interacts with the N-terminus of ACKR3. Interacts with integrin subunit ITGB3 (via the allosteric site (site 2)).

(Microbial infection) Interacts with molluscum contagiosum virus protein MC148.

Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Development > Axon guidance.   (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

· Organismal Systems > Immune system > Intestinal immune network for IgA production.   (View pathway)

References

1). CircNf1-mediated CXCL12 expression in the spinal cord contributes to morphine analgesic tolerance. Brain, Behavior, and Immunity, 2023 (PubMed: 36202171) [IF=15.1]

2). Highly efficient local delivery of endothelial progenitor cells significantly potentiates angiogenesis and full-thickness wound healing. Acta Biomaterialia, 2018 (PubMed: 29397318) [IF=9.7]

Application: WB    Species: rat    Sample: EPCs

Fig. 2 | CPB scaffolds activate the HIF-1 a /VEGF/SDF-1 a signaling pathway in EPCs. (A) Western blot analysis and quantification of Hif-1 a , VEGF, and SDF-1 a proteins in EPCs cultured on scaffolds for 3 days; (B) fluorescent images of F-actin (red) and Hif-1 a (green) in EPCs cultured on scaffolds for 3 days; (C) quantification of the cellular immunofluorescence intensity of Hif-1 a ; Scale bar are 20 l m, n = 3 independent experiments.

3). Kangfuxin Accelerates Extraction Socket Healing by Promoting Angiogenesis Via Upregulation of CCL2 in Stem Cells. Journal of Bone and Mineral Research, 2023 (PubMed: 37221128) [IF=6.2]

4). Injectable Silk Nanofiber Hydrogels for Sustained Release of Small-Molecule Drugs and Vascularization. ACS Biomaterials Science & Engineering, 2019 (PubMed: 33448809) [IF=5.8]

5). Silencing c-Myc Enhances the Antitumor Activity of Bufalin by Suppressing the HIF-1α/SDF-1/CXCR4 Pathway in Pancreatic Cancer Cells. Frontiers in Pharmacology, 2020 (PubMed: 32362830) [IF=5.6]

Application: WB    Species: Human    Sample: pancreatic cancer cells

Figure 6 Downregulation of c-Myc enhanced the antitumor effect of bufalin in pancreatic cancer cells through the HIF-1α/SDF-1/CXCR4 pathway. (A) The protein expression of c-Myc, vimentin, E-cadherin, HIF-1α, CXCR4, and SDF-1 in PANC-1 and SW1990 pancreatic cancer cells under different treatments was detected via western blot. (B) Quantification results of protein expressions of c-Myc, vimentin, E-cadherin, HIF-1α, CXCR4, and SDF-1 in PANC-1 pancreatic cancer cells. (C) Quantification results of protein expression of c-Myc, vimentin, E-cadherin, HIF-1α, CXCR4, and SDF-1 in SW1990 pancreatic cancer cells (* p < 0.05, ** p < 0.01 vs control, ▲ p < 0.05, ▲▲ p < 0.01 vs bufalin treatment group, n = 3).

6). Chronic Intermittent Hypobaric Hypoxia Enhances Bone Fracture Healing. Frontiers in Endocrinology, 2021 (PubMed: 33664707) [IF=5.2]

Application: WB    Species: Rat    Sample: CIHH rats

Figure 5 The expression of SDF-1 and CXCR4 axis at fracture sites. (A) Western blot images of SDF-1, CXCR4, and β-actin in the callus area. (B) Quantitative real-time PCR of the callus SDF-1α. (C) Quantitative real-time PCR of the callus CXCR4. n=6, Mean ± SD, *p < 0.05, **p < 0.01, ***p < 0.001.

7). The protective effects of umbilical cord‐derived endothelial colony forming cells on hepatic veno‐occlusive disease. CELL BIOLOGY INTERNATIONAL, 2020 (PubMed: 32876991) [IF=3.9]

8). Zoledronic acid generates a spatiotemporal effect to attenuate osteoarthritis by inhibiting potential Wnt5a-associated abnormal subchondral bone resorption. PLOS ONE, 2021 (PubMed: 35900969) [IF=3.7]

Application: IHC    Species: Rat    Sample:

Fig 7 ZOL attenuates the expression of Wnt5a and osteoclastogenesis genes 4 weeks after DMM-induced OA. Expression of (A) Wnt5a, (B) CXCL12 and (C) NFATc1 determined by immunohistochemical staining and by (E) quantitative analysis. Scale bar, 200 μm. n = 6 per group. (D) Western blots and (F) quantitation of Wnt5a, RANKL, CXCL12 and NFATc1. Reverse transcription quantitative polymerase chain reaction of (G) Wnt5a, CXCL12, NFATc1, (H) RANKL, OPG, RANKL/OPGand (I) TRAP, Ctsk. n = 3 per group. *P < 0.05, **P < 0.01, and ***P < 0.001, compared with sham+PBS group; #P < 0.05, ##P < 0.01, and ###P < 0.001, compared with DMM+PBS group.

Application: WB    Species: Rat    Sample:

Fig 7 ZOL attenuates the expression of Wnt5a and osteoclastogenesis genes 4 weeks after DMM-induced OA. Expression of (A) Wnt5a, (B) CXCL12 and (C) NFATc1 determined by immunohistochemical staining and by (E) quantitative analysis. Scale bar, 200 μm. n = 6 per group. (D) Western blots and (F) quantitation of Wnt5a, RANKL, CXCL12 and NFATc1. Reverse transcription quantitative polymerase chain reaction of (G) Wnt5a, CXCL12, NFATc1, (H) RANKL, OPG, RANKL/OPGand (I) TRAP, Ctsk. n = 3 per group. *P < 0.05, **P < 0.01, and ***P < 0.001, compared with sham+PBS group; #P < 0.05, ##P < 0.01, and ###P < 0.001, compared with DMM+PBS group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.