Product: BMP2 Antibody
Catalog: AF5163
Description: Rabbit polyclonal antibody to BMP2
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 14~20kD(monomer), 30~40kD(dimer), 44~60kD(precursor); 45kD(Calculated).
Uniprot: P12643
RRID: AB_2837649

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(91%), Horse(100%), Sheep(91%), Rabbit(91%), Dog(100%), Chicken(100%), Xenopus(82%)
Clonality:
Polyclonal
Specificity:
BMP2 Antibody detects endogenous levels of total BMP2.
RRID:
AB_2837649
Cite Format: Affinity Biosciences Cat# AF5163, RRID:AB_2837649.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BMP 2; BMP 2A; BMP2; BMP2A; Bone morphogenetic protein 2;

Immunogens

Immunogen:

A synthesized peptide derived from human BMP2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P12643 BMP2_HUMAN:

Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.

Description:
Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.
Sequence:
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Dog
100
Chicken
100
Bovine
91
Sheep
91
Rabbit
91
Xenopus
82
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Induces cartilage and bone formation. Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.

Family&Domains:

Belongs to the TGF-beta family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

References

1). Microenvironment-responsive multifunctional enzyme-linked hydrogel for diabetic bone defect regeneration. Nature communications, 2025 (PubMed: 41271711) [IF=16.6]

Application: WB    Species: Rat    Sample:

Fig. 7: Functional and mechanistic insights of AAT-ZCG for DM bone defects in regulating FoxO1/P53 signaling pathways. A Volcano plot showing differentially expressed genes (DEGs) between experimental and control groups. Red dots indicate up-regulated genes, and blue dots indicate down-regulated genes. B Gene Ontology (GO) enrichment analysis of up-regulated genes. C GO enrichment analysis of down-regulated genes. D Heatmap of the expression levels of DEGs across experimental groups, with specific key genes like FoxO1 highlighted. E Kyoto encyclopedia of genes and genomes (KEGG) pathway analysis of DEGs, identifying significant pathways such as P53 signaling, FoxO1 signaling. F Schematic diagram illustrates the proposed mechanism of AAT-ZCG in activating the forkhead box O1 (FoxO1) and P53 pathways. G Western blot was conducted to evaluate the effects of AAT-ZCG on inflammation and osteogenesis through the FoxO1/P53 signaling pathway. H The effect of AAT-ZCG on the expression of FoxO1, n = 3. I The effect of AAT-ZCG on P53 expression, n = 3. J The effect of AAT-ZCG on the expression of pP53, n = 3. K The effect of AAT-ZCG on the expression of MMP13, n = 3. L The effect of AAT-ZCG on the expression of BMP2, n = 3. M) The effect of AAT-ZCG on the expression of Acp5, n = 3. Data are presented as mean ± SD. Figure 7H-M involved three biological replications (n = 3) and analysis of these experiments’ results were performed using one-way ANOVA. ns, no statistical significance. Statistical significance is indicated as follows: P 

Application: IF/ICC    Species: Rat    Sample:

Fig. 8: Evaluation of therapeutic effect of AAT-ZCG in vivo. A, B Disintegration of AAT-ZCG in diabetic rats characterized by in vivo imaging of small animals. C CT images of diabetic cranial defect rats at 4 weeks and 8 weeks in different treatment groups. D BV/TV results of each treatment group at 8 weeks. E BS/BV results of each treatment group at 8 weeks. F Histological analysis by hematoxylin and eosin (H&E) staining and massion staining at 8 weeks. G Immunofluorescence staining of Runx2 and BMP2 at 8 weeks. H, I 8 weeks Runx2 and BMP2 immunofluorescence staining relative fluorescence intensity quantification. Blue: DAPI, excitation wavelength (Ex): 405 nm, endow with pseudo-color: RGB (0, 0, 255); Green: BMP2, Ex: 488 nm, endow with pseudo-color: RGB (0, 255, 0); Red: Runx2, Ex: 640 nm, endow with pseudo-color: RGB (255, 0, 0). Data are presented as mean ± SD. Figure 8B involved three biological replications (n = 3), Fig. 8D-E, H-I involved four biological replications (n = 4). Analysis of these experiments’ results were performed using one-way ANOVA. ns, no statistical significance. *P 

2). Novel lncRNA LncMSTRG.11341.25 Promotes Osteogenic Differentiation of Human Bone Marrow Stem Cells via the miR-939-5p/PAX8 Axis. Research (Washington, D.C.), 2025 (PubMed: 39916798) [IF=11.0]

Application: WB    Species: human    Sample:

Fig. 4. LncMSTRG25 knockdown inhibited osteogenic differentiation of hBMSCs. (A and B) hBMSCs were transfected with siLncMSTRG25-1, siLncMSTRG25-2, and the negative control and induced to differentiate into osteoblasts for 7 d. To evaluate protein expression levels, Western blotting was performed like PAX8, ALP, BMP2, RUNX2, COLL1, OPN, and OCN. (C and D) qPCR was used to detect the relative expression levels of miR-939-5p, LncMSTRG25-1, PAX8, ALP, BMP2, RUNX2, COLL1, OPN, and OCN. (E) hBMSCs were transfected with siLncMSTRG25-1, siLncMSTRG25-2, or a negative control and induced to differentiate into osteoblasts for 14 d. ARS and ALP staining methods were utilized to identify osteoblast differentiation. (F) Immunofluorescence with specific antibodies was used to detect the expression of PAX8, BMP2, and RUNX2 following 7 d of osteoblast differentiation. Data are the mean ± SD of 3 independent experiments. *P < 0.05, **P < 0.01, ***P < 0.001, and ****P < 0.0001.

3). A novel hierarchical biofunctionalized 3D-printed porous Ti6Al4V scaffold with enhanced osteoporotic osseointegration through osteoimmunomodulation. Journal of nanobiotechnology, 2022 (PubMed: 35123501) [IF=10.2]

Application: WB    Species: Rat    Sample: rBMSCs

Fig. 3 Detection of osteogenic differentiation markers of rBMSCs. a, b ALP staining and activity of rBMSCs cultured in conditioned medium for 7 and 14 days. c ALP immunofluorescent staining of rBMSC in conditioned medium for 7 days: green (ALP), red (actin), blue (Nucleus/DAPI). d OCN immunofluorescent staining of rBMSC in conditioned medium for 14 days: green (ALP), red (actin), blue (Nucleus/DAPI). e Alizarin Red staining of rBMSC cultured in conditioned medium for 14 days. f Quantitative analysis of Alizarin Red staining. g ALP, BMP-2 and OCN western blotting bands of rBMSC in conditioned medium for 14 days. h–j The expressions of ALP, BMP-2 and OCN proteins were quantitatively analyzed by Image J. (n = 3; *, # and + represent P 

4). A novel multifunctional nanocomposite hydrogel orchestrates the macrophage reprogramming-osteogenesis crosstalk to boost bone defect repair. Journal of nanobiotechnology, 2024 (PubMed: 39533396) [IF=10.2]

Application: IF/ICC    Species: Rat    Sample:

Fig. 5 Osteogenic and osteoclastic differentiation of hydrogel. (A, B) ALP staining. (C, D) ARS staining. (E, F) Immunofluorescence staining of BMP-2 and OCN. (G) ALP activity assay. (H, I) Quantitative analysis of ALP and ARS staining. (J, K) Quantitative analysis of BMP-2 and OCN immunofluorescence staining. (L, M) Immunofluorescence staining and quantitative analysis of CTR immunofluorescence staining. (N) TRAP staining of BMDMs-derived osteoclasts. (NS, no significant difference; *, P 

5). Peripheral nerves modulate the peri-implant osteogenesis under type 2 diabetes through exosomes derived from schwann cells via miR-15b-5p/Txnip signaling axis. Journal of nanobiotechnology, 2025 (PubMed: 39875954) [IF=10.2]

Application: WB    Species: rat    Sample: BMSCs

Fig. 3 Exosome uptake assay and impact on BMSCs osteogenic differentiation. (A) Exosome uptake assay demonstrating the internalization of PKH67-labeled exosomes by BMSCs. (B) Cytotoxicity test demonstrating the appropriate exosomes dose for treatment (n = 3 per group). (C-F) ALP staining and Alizarin red staining indicating mineralization in BMSCs. Quantitative analysis illustrates the mineralization proportion, which was enhanced by L-exos and reduced by H-exos in comparison to the PBS group (n = 3 per group). (J-M) Western blotting and (G-I) qRT-PCR analyses of osteogenesis-related genes in BMSCs treated with 25 µg/ml L-exos, 25 µg/ml H-exos, or equal quantities of PBS. Protein and mRNA levels of RUNX2, BMP2, and OCN were downregulated in H-exo groups compared to L-exo group (n = 3 per group). The error bars represent the means ± SDs.

6). Mechanosensitive Piezo1 is crucial for periosteal stem cell-mediated fracture healing. International Journal of Biological Sciences, 2023 (PubMed: 35844802) [IF=8.2]

7). Osteogenic potential evaluation of biotin combined with magnesium-doped hydroxyapatite sustained-release film. Materials science & engineering-C, Materials for biological applications, 2022 (PubMed: 35581076) [IF=8.1]

8). Magnesium-enriched microenvironment promotes odontogenic differentiation in human dental pulp stem cells by activating ERK/BMP2/Smads signaling. Stem Cell Research & Therapy, 2019 (PubMed: 31823825) [IF=7.5]

Application: WB    Species: Human    Sample: DPSCs

Fig. 6 The ERK and BMP2 signaling pathway is activated by high extracellular Mg2+ in DPSCs during odontogenic differentiation. a ERK phosphorylation was significantly enhanced in DPSCs treated with 1 mM, 5 mM, and 10 mM Mg2+ compared with the 0 mM Mg2+ group, but p38 and JNK phosphorylation amounts were unchanged. b ERK phosphorylation was reduced by 2-APB. c Consistently, the protein levels of BMP2, BMPR1, and phosphorylated Smad1/5/9 were significantly increased in DPSCs exposed to high extracellular Mg2+. d BMP2, BMPR1, and phosphorylated Smad1/5/9 protein amounts were decreased by 2-APB

9). MicroRNA-93-5p regulates odontogenic differentiation and dentin formation via KDM6B. Journal of translational medicine, 2024 (PubMed: 38218880) [IF=7.4]

10). Extracellular vesicles from the inflammatory microenvironment regulate the osteogenic and odontogenic differentiation of periodontal ligament stem cells by miR-758-5p/LMBR1/BMP2/4 axis. Journal of translational medicine, 2022 (PubMed: 35562763) [IF=7.4]

Application: WB    Species: human    Sample:

Fig. 7 Knock-down of LMBR1 promoted the osteogenic and odontogenic differentiation of PDLSCs. A The potential binding site between miR-758-5p and LMBR1 predicted by bioinformatics. B Dual-luciferase reporter assay demonstrated the correlation between miR-758-5p and LMBR1. C qRT-PCR evaluated the downregulation of LMBR1 by siRNAs. D Western blot evaluated the suppression of LMBR1 by siRNAs. E The results of the CCK-8 assay showed cell proliferation after the downregulation of LMBR1. F Relative mRNA levels of ALP, DSPP, OSX, and RUNX2 when LMBR1 was knocked down. G Western blot assay showed the expression of ALP, DSPP, OSX, and RUNX2 after transfection of siRNAs. H Histogram derived from relative protein expression of western blot. I Result of ARS staining. J Quantification of ARS staining. K Result of ALP staining. L Western blot showed the condition of BMP2 and BMP4 when miR-758-5p was overexpressed or inhibited. M Western blot showed the condition of BMP2 and BMP4 when LMBR1 was knocked down. N Protein levels of ALP, DSPP, RUNX2 and OSX in rescue experiment. O Protein levels of BMP2 and BMP4 in rescue experiment. n = 3, ***P 

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.