Product: BMP2 Antibody
Catalog: AF5163
Description: Rabbit polyclonal antibody to BMP2
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 14~20kD(monomer), 30~40kD(dimer), 44~60kD(precursor); 45kD(Calculated).
Uniprot: P12643
RRID: AB_2837649

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(91%), Horse(100%), Sheep(91%), Rabbit(91%), Dog(100%), Chicken(100%), Xenopus(82%)
Clonality:
Polyclonal
Specificity:
BMP2 Antibody detects endogenous levels of total BMP2.
RRID:
AB_2837649
Cite Format: Affinity Biosciences Cat# AF5163, RRID:AB_2837649.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BMP 2; BMP 2A; BMP2; BMP2A; Bone morphogenetic protein 2;

Immunogens

Immunogen:

A synthesized peptide derived from human BMP2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P12643 BMP2_HUMAN:

Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.

Description:
Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.
Sequence:
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Dog
100
Chicken
100
Bovine
91
Sheep
91
Rabbit
91
Xenopus
82
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Induces cartilage and bone formation. Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.

Family&Domains:

Belongs to the TGF-beta family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Basal cell carcinoma.   (View pathway)

References

1). Novel lncRNA LncMSTRG.11341.25 Promotes Osteogenic Differentiation of Human Bone Marrow Stem Cells via the miR-939-5p/PAX8 Axis. Research (Washington, D.C.), 2025 (PubMed: 39916798) [IF=11.0]

Application: WB    Species: human    Sample:

Fig. 4. LncMSTRG25 knockdown inhibited osteogenic differentiation of hBMSCs. (A and B) hBMSCs were transfected with siLncMSTRG25-1, siLncMSTRG25-2, and the negative control and induced to differentiate into osteoblasts for 7 d. To evaluate protein expression levels, Western blotting was performed like PAX8, ALP, BMP2, RUNX2, COLL1, OPN, and OCN. (C and D) qPCR was used to detect the relative expression levels of miR-939-5p, LncMSTRG25-1, PAX8, ALP, BMP2, RUNX2, COLL1, OPN, and OCN. (E) hBMSCs were transfected with siLncMSTRG25-1, siLncMSTRG25-2, or a negative control and induced to differentiate into osteoblasts for 14 d. ARS and ALP staining methods were utilized to identify osteoblast differentiation. (F) Immunofluorescence with specific antibodies was used to detect the expression of PAX8, BMP2, and RUNX2 following 7 d of osteoblast differentiation. Data are the mean ± SD of 3 independent experiments. *P < 0.05, **P < 0.01, ***P < 0.001, and ****P < 0.0001.

2). A novel multifunctional nanocomposite hydrogel orchestrates the macrophage reprogramming-osteogenesis crosstalk to boost bone defect repair. Journal of nanobiotechnology, 2024 (PubMed: 39533396) [IF=10.2]

3). Peripheral nerves modulate the peri-implant osteogenesis under type 2 diabetes through exosomes derived from schwann cells via miR-15b-5p/Txnip signaling axis. Journal of nanobiotechnology, 2025 (PubMed: 39875954) [IF=10.2]

4). Mechanosensitive Piezo1 is crucial for periosteal stem cell-mediated fracture healing. International Journal of Biological Sciences, 2023 (PubMed: 35844802) [IF=8.2]

5). Osteogenic potential evaluation of biotin combined with magnesium-doped hydroxyapatite sustained-release film. Materials science & engineering-C, Materials for biological applications, 2022 (PubMed: 35581076) [IF=8.1]

6). Magnesium-enriched microenvironment promotes odontogenic differentiation in human dental pulp stem cells by activating ERK/BMP2/Smads signaling. Stem Cell Research & Therapy, 2019 (PubMed: 31823825) [IF=7.5]

Application: WB    Species: Human    Sample: DPSCs

Fig. 6 The ERK and BMP2 signaling pathway is activated by high extracellular Mg2+ in DPSCs during odontogenic differentiation. a ERK phosphorylation was significantly enhanced in DPSCs treated with 1 mM, 5 mM, and 10 mM Mg2+ compared with the 0 mM Mg2+ group, but p38 and JNK phosphorylation amounts were unchanged. b ERK phosphorylation was reduced by 2-APB. c Consistently, the protein levels of BMP2, BMPR1, and phosphorylated Smad1/5/9 were significantly increased in DPSCs exposed to high extracellular Mg2+. d BMP2, BMPR1, and phosphorylated Smad1/5/9 protein amounts were decreased by 2-APB

7). MicroRNA-93-5p regulates odontogenic differentiation and dentin formation via KDM6B. Journal of translational medicine, 2024 (PubMed: 38218880) [IF=7.4]

8). Role of LRP5/6/GSK-3β/β-catenin in the differences in exenatide- and insulin-promoted T2D osteogenesis and osteomodulation. British journal of pharmacology, 2024 (PubMed: 38804080) [IF=6.8]

9). Alternative splicing of EZH2 regulated by SNRPB mediates hepatocellular carcinoma progression via BMP2 signaling pathway. iScience, 2024 (PubMed: 39850359) [IF=5.8]

10). Specnuezhenide Alleviates Senile Osteoporosis by Activating TGR5/FXR Signaling in Bone Marrow Mesenchymal Stem Cells and RANKL-Induced Osteoclasts. Drug design, development and therapy, 2025 (PubMed: 40066080) [IF=4.7]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.