Product: RANTES Antibody
Catalog: AF5151
Description: Rabbit polyclonal antibody to RANTES
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 9 kDa; 10kD(Calculated).
Uniprot: P13501
RRID: AB_2837637

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(89%)
Clonality:
Polyclonal
Specificity:
RANTES Antibody detects endogenous levels of total RANTES.
RRID:
AB_2837637
Cite Format: Affinity Biosciences Cat# AF5151, RRID:AB_2837637.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta chemokine RANTES; Beta chemokine RANTES precursor; C C motif chemokine 5; CCL 5; CCL5; CCL5_HUMAN; Chemokine (C C motif) ligand 5; Chemokine CC Motif Ligand 5; D17S136E; EoCP; Eosinophil chemotactic cytokine; MGC17164; RANTES(4-68); Regulated upon activation normally T expressed and presumably secreted; SCYA 5; SCYA5; SIS delta; SIS-delta; SISd; Small inducible cytokine A5 (RANTES); Small inducible cytokine A5; Small inducible cytokine subfamily A (Cys Cys) member 5; Small-inducible cytokine A5; T cell specific protein p288; T cell specific RANTES protein; T cell-specific protein P228; T-cell-specific protein RANTES; TCP 228; TCP228;

Immunogens

Immunogen:

A synthesized peptide derived from human RANTES, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P13501 CCL5_HUMAN:

Expressed in the follicular fluid (at protein level). T-cell and macrophage specific.

Description:
Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Sequence:
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Rabbit
100
Dog
89
Xenopus
67
Chicken
56
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

PTMs:

N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.

The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in. They are assigned by similarity.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the follicular fluid (at protein level). T-cell and macrophage specific.

Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Infectious diseases: Bacterial > Epithelial cell signaling in Helicobacter pylori infection.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

References

1). Osteopontin deficiency promotes cartilaginous endplate degeneration by enhancing the NF-κB signaling to recruit macrophages and activate the NLRP3 inflammasome. Bone research, 2024 (PubMed: 39242551) [IF=14.3]

2). Hyperphosphorylated tau mediates neuronal death by inducing necroptosis and inflammation in Alzheimer’s disease. Journal of Neuroinflammation, 2022 (PubMed: 35971179) [IF=9.3]

Application: WB    Species: Mouse    Sample: HT22 cells

Fig. 2Hyperphosphorylated tau induces cytokine upregulation. A Differentially expressed genes (DEGs) between HT22 cells transfected with vector or TauP301S for 48 h. B Analysis of DEGs in the TauP301S and Tau groups according to the Kyoto Encyclopedia of Genes and Genomes (KEGG) database. C Heat map of cytokine genes differentially expressed in HT22 cells transfected with vector or Tau or TauP301S following treatment with DMSO or Nec-1 (30 μM); low expression is shown in blue and high expression in red. D mRNAs from HT22 cells transfected with vector or TauP301S following treatment with DMSO or Nec-1 (30 μM) were extracted and quantified to determine indicated cytokine levels by qPCR. E Cytokine levels in HT22 cells transfected with vector or TauP301S following treatment with DMSO or Nec-1 (30 μM) were analyzed by western blotting with the indicated antibodies. F ROS levels in HT22 cells transfected with vector or TauP301S. G Chemotaxis of pTau-induced cytokines on BV2 cells was analyzed by transwell assays, Scale bars, 100 μm. Data are presented as the mean ± standard error of the mean (SEM) of three experiments, and statistical analysis was performed using one-way ANOVA with Dunnett’s multiple comparisons test in D and two-tailed unpaired t test in F, G

3). CCL5 derived from tumor-associated macrophages promotes prostate cancer stem cells and metastasis via activating β-catenin/STAT3 signaling. Cell Death & Disease, 2020 (PubMed: 32300100) [IF=8.1]

Application: WB    Species: human    Sample: prostate cancer cells

Fig. 3 TAM-secreted CCL5 promoted the invasion of prostate cancer cells and the self-renewal of PCSCs. a, b The reliability of THP1-derived TAMs was validated by analyzing the macrophage surface markers. THP1 monocytes were induced differentiation into macrophages (M0) by 100 ng/ ml PMA treatment for 24 h, which were further transformed into M2 phenotype macrophages (TAMs) by 10 ng/ml IL-4 induction for 72 h. c, d The CM of THP1-derived TAMs significantly promoted EMT, migration and invasion of prostate cancer cells, while CCL5 NA could partly abrogate that. Scale bars represent 200 μm for wound healing assay images and 50 μm for transwell assay images. e The CM of THP1-derived TAMs significantly promoted the self-renewal of PCSCs, while CCL5 NA could partly abrogate that. All values are presented as the mean ± SD. n = 3, *p < 0.05, **p < 0.01.

Application: IF/ICC    Species: human    Sample: prostate cancer cells

Fig. 1 TAMs-derived CCL5 was elevated in prostate cancer and associated with metastasis. a, b The mRNA and protein expression differences of indicated genes between prostate cancer tumor tissues and para-carcinoma tissues (n = 3). c Elisa assay indicated that the blood samples of prostate cancer patients (n = 30) exhibited elevated expression of CCL5 when compared with that of healthy male participants (n = 30). d Prostate cancer patients with higher Gleason grade exhibited an increased CCL5 accumulation in the blood (n = 30). e Tissue immunofluorescence assay suggested that CCL5 and the macrophage marker CD163 were co-localized in both the primary tumor and metastatic lymph node of prostate cancer patients. Scale bar, 10 μm. f TAMs exhibited increased secretion of CCL5 than immature macrophages or prostate cancer cells. CCL5 concentrations in the cell culture supernatants of THP1-derived macrophages (M0), THP1-derived TAMs (M2), DU145 and PC3 cells were measured using Elisa method (n = 10). All values are presented as the mean ± SD. *p < 0.05, **p < 0.01.

4). FKBP5-CCL5 interaction promotes neuroinflammation and neuronal apoptosis in ischemic stroke by regulating the MAPK pathway and enhancing NET formation. Frontiers in immunology, 2025 (PubMed: 41098728) [IF=5.7]

Application: WB    Species: Mouse    Sample: BV2 cells

Figure 5 Interaction between FKBP5 and CCL5. (A) Visualization of the rigid molecular simulations showing the docking interaction between FKBP5 and CCL5. The docking results indicate that the free energy is below zero, suggesting spontaneous docking. CCL5 is represented in blue and FKBP5 in cyan, while the regions of interaction are highlighted in red and green. (B) Immunofluorescence staining of CCL5 (red) and FKBP5 (green) within the cells. The overlap in fluorescence signals indicates areas where both proteins are present together. Scale bar indicates 20μm. (C) Western blot analysis to detect FKBP5 in protein-antibody complexes purified from Co-IP assays. Relative expression of FKBP5 (D) and CCL5 (E) in BV2 cells by qPCR in different groups. Representative western blotting images (F) and quantitative analysis (G) of FKBP5 (left panel) and CCL5 (right panel) in BV2 cells. n = 3.

Application: IF/ICC    Species: Mouse    Sample: BV2 cells

Figure 5 Interaction between FKBP5 and CCL5. (A) Visualization of the rigid molecular simulations showing the docking interaction between FKBP5 and CCL5. The docking results indicate that the free energy is below zero, suggesting spontaneous docking. CCL5 is represented in blue and FKBP5 in cyan, while the regions of interaction are highlighted in red and green. (B) Immunofluorescence staining of CCL5 (red) and FKBP5 (green) within the cells. The overlap in fluorescence signals indicates areas where both proteins are present together. Scale bar indicates 20μm. (C) Western blot analysis to detect FKBP5 in protein-antibody complexes purified from Co-IP assays. Relative expression of FKBP5 (D) and CCL5 (E) in BV2 cells by qPCR in different groups. Representative western blotting images (F) and quantitative analysis (G) of FKBP5 (left panel) and CCL5 (right panel) in BV2 cells. n = 3.

5). A novel long noncoding RNA, TMEM92‐AS1, promotes gastric cancer progression by binding to YBX1 to mediate CCL5. Molecular Oncology, 2021 (PubMed: 33247987) [IF=5.0]

Application: WB    Species: human    Sample: BGC823 and SGC7901 cells

Figure 4 CCL5 was confirmed as a downstream target gene of TMEM92-AS1. (A and B) RT-qPCR and western blot were used to verify changed genes and proteins after TMEM92-AS1 knockdown.

Application: WB    Species: human    Sample: BGC823 cells

Figure 5(C) RT-qPCR and western blot were performed to detect CCL5 expressions after YBX1 knockdown.

Application: WB    Species: human    Sample: BGC823 cells

Figure 5(E) RT-qPCR and western blot were performed to detect the effect of TMEM92-AS1 overexpression and YBX1 knockdown on CCL5 expression.

Application: WB    Species: human    Sample: BGC823 cells

Figure 5 (G) ChIP results of YBX1 of the promoter region of CCL5 after si-TMEM92-AS1 2# in BGC823 cell

6). The myokine CCL5 recruits subcutaneous preadipocytes and promotes intramuscular fat deposition in obese mice. American journal of physiology. Cell physiology, 2024 (PubMed: 38497114) [IF=5.0]

Application: WB    Species: Mouse    Sample:

Figure 2. The chemokine (C-C motif) ligand 5 (CCL5)/chemokine (C-C motif) receptor 5 (CCR5) pathway regulates the migration of 3T3-L1 preadipocytes to C2C12 myotubes. A and B: representative bright-field micrographs and quantification results of crystal violet-stained transwell membranes for 3T3-L1 preadipocyte migration by adding recombinant CCL5 (rCCL5) at concentrations of 0, 5, 10, and 20 ng/mL. Scale bar, 200 μm. n = 3. C: the relative mRNA expression of Ccl5 in C2C12 myotubes transfected with negative control siRNA (siNC) or with siRNA silencing CCL5 (siCCL5), normalized to siNC. Gapdh was used as the internal reference gene. n = 3. D: Western blot analysis and quantification of CCL5 in C2C12 myotubes transfected with siNC or with siCCL5. n = 3. E and F: representative bright-field micrographs of crystal violet-stained transwell membranes and corresponding quantification for each treatment group. The treatment involved the migration of 3T3-L1 preadipocytes in a coculture system with C2C12 myotubes that were transfected with siNC, siCCL5, siNC + rCCL5 (20 ng/mL), and siCCL5 + rCCL5 (20 ng/mL). Scale bar, 200 μm. n = 3. G and H: the relative mRNA expression of Ccr5 and Western blot analysis of CCR5 in 3T3-L1 preadipocytes treated with DMEM (NC) or conditioned media from differentiated C2C12 cells for 0 and 6 days. n = 3. I: the relative mRNA expression of Ccr5 in 3T3-L1 cells transfected with pcDNA3.1 vectors or overexpression vectors containing the coding sequence (CDS) region of CCR5 (pc-CCR5). n = 3. J: representative bright-field micrographs and quantification results of crystal violet-stained trans well filters for 3T3-L1 preadipocyte migration. The treatments involved the 3T3-L1 preadipocyte migration in a coculture system with C2C12 myotubes. The 3T3-L1 preadipocytes were transduced with pcDNA3.1 or pc-CCR5 vectors. Scale bar, 200 μm. n = 3. K: representative bright-field micrographs and quantification results of crystal violet-stained trans well filters for 3T3-L1 preadipocyte migration. The coculture system involved C2C12 myotubes that were treated with MARAVIROC (MVC) (0.1 μm) or not. Scale bar, 200 μm. n = 3.

7). IL-17D affects the chemokines and chemokine receptors of intestinal epithelial cells under hyperoxia. International immunopharmacology, 2022 (PubMed: 36461593) [IF=4.8]

8). ASCT2-mediated glutamine uptake of epithelial cells facilitates CCL5-induced T cell infiltration via ROS-STAT3 pathway in oral lichen planus. International immunopharmacology, 2023 (PubMed: 37116342) [IF=4.8]

9). C-C motif chemokine ligand 5 contributes to radon exposure-induced lung injury by recruiting dendritic cells to activate effector T helper cells. Toxicology, 2025 (PubMed: 39746565) [IF=4.8]

10). RNA demethylase ALKBH5 suppresses tumorigenesis via inhibiting proliferation and invasion and promoting CD8+ T cell infiltration in colorectal cancer. Translational Oncology, 2023 (PubMed: 37224767) [IF=4.5]

Application: WB    Species: Human    Sample: HCT116 and SW620 cells

Fig. 6 ALKBH5 disrupting NF-κB-CCL5 signaling. a-b Relative expression of CCL5 in ALKBH5-overexpressed HCT116 and SW620 cells. c Immunohistochemistry was used to detect the expression of ALKBH5, p65, CCL5, and CD8 in human colorectal cancer tissues, the data represented mean ± SD (n=56). d CCL5 expression and the total and phosphorylation level of p65 and IκB-α after ALKBH5 overexpression were examined by western blot analysis. e SW620 were pretreated with 100 and 200 ng/ml of specific NF-κB activator PMA, and western blot analysis was to assess the expression of CCL5 and p-p65.

Application: IHC    Species: Human    Sample: HCT116 and SW620 cells

Fig. 6 ALKBH5 disrupting NF-κB-CCL5 signaling. a-b Relative expression of CCL5 in ALKBH5-overexpressed HCT116 and SW620 cells. c Immunohistochemistry was used to detect the expression of ALKBH5, p65, CCL5, and CD8 in human colorectal cancer tissues, the data represented mean ± SD (n=56). d CCL5 expression and the total and phosphorylation level of p65 and IκB-α after ALKBH5 overexpression were examined by western blot analysis. e SW620 were pretreated with 100 and 200 ng/ml of specific NF-κB activator PMA, and western blot analysis was to assess the expression of CCL5 and p-p65.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.