Product: Smad7 Antibody
Catalog: AF5147
Description: Rabbit polyclonal antibody to Smad7
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Rabbit, Dog
Mol.Wt.: 46 kDa; 46kD(Calculated).
Uniprot: O15105
RRID: AB_2837633

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(94%), Rabbit(100%), Dog(87%)
Clonality:
Polyclonal
Specificity:
Smad7 Antibody detects endogenous levels of total Smad7.
RRID:
AB_2837633
Cite Format: Affinity Biosciences Cat# AF5147, RRID:AB_2837633.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CRCS3; FLJ16482; hSMAD 7; hSMAD7; MAD (mothers against decapentaplegic Drosophila) homolog 7; MAD; Mad homolog 7; MAD homolog 8; MAD mothers against decapentaplegic homolog 7; MADH 7; MADH 8; MADH6; MADH8; Mothers Against Decapentaplegic Drosophila Homolog of 6; Mothers Against Decapentaplegic Drosophila Homolog of 7; Mothers against decapentaplegic homolog 7; Mothers against decapentaplegic homolog 8; Mothers against DPP homolog 7; Mothers against DPP homolog 8; SMA- AND MAD-RELATED PROTEIN 7; SMAD 7; SMAD; SMAD family member 7; SMAD, mothers against DPP homolog 7 (Drosophila); SMAD, mothers against DPP homolog 7; SMAD6; Smad7; SMAD7_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Smad7, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O15105 SMAD7_HUMAN:

Ubiquitous with higher expression in the lung and vascular endothelium.

Description:
Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation.
Sequence:
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Pig
100
Bovine
94
Dog
87
Chicken
50
Zebrafish
33
Horse
0
Sheep
0
Xenopus
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

PTMs:

Phosphorylation on Ser-249 does not affect its stability, nuclear localization or inhibitory function in TGFB signaling; however it affects its ability to regulate transcription (By similarity). Phosphorylated by PDPK1.

Ubiquitinated by WWP1 (By similarity). Polyubiquitinated by RNF111, which is enhanced by AXIN1 and promotes proteasomal degradation. In response to TGF-beta, ubiquitinated by SMURF1; which promotes its degradation.

Acetylation prevents ubiquitination and degradation mediated by SMURF1.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous with higher expression in the lung and vascular endothelium.

Family&Domains:

Belongs to the dwarfin/SMAD family.

Research Fields

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

References

1). Multi-drug loaded electrospinning nanofibers promote healing with less scar formation by remodeling wound microenvironment via modulating TGF-β1/Smads/EN1 signal. Chemical Engineering Journal, 2024 [IF=13.3]

2). FOXO3 regulates Smad3 and Smad7 through SPON1 circular RNA to inhibit idiopathic pulmonary fibrosis. International Journal of Biological Sciences, 2023 (PubMed: 37416778) [IF=8.2]

3). miR‑29b suppresses proliferation and induces apoptosis of hepatocellular carcinoma ascites H22 cells via regulating TGF‑β1 and p53 signaling pathway. INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE, 2021 (PubMed: 34184070) [IF=5.7]

Application: WB    Species: Mice    Sample: H22 cells

Figure 4 Effect of miR-29b on the TGF-β1 signaling pathway in H22 cells. (A and B) Western blot analysis of TGF-β1, p-Smad3 and Smad7. (C-E) Protein intensities of TGF-β1, p-Smad3 and Smad7. Values represent the means ± SD (n=3). (F-H) mRNA levels of TGF-β1, Smad3 and Smad7. Values represent the means ± SD (n=5). #P<0.05 and ##P<0.01 vs. control mimic; *P<0.05 and **P<0.01 vs. control inhibitor. miR, microRNA; TGF, transforming growth factor; SD, standard deviation; p-, phosphorylated.

4). Mesenchymal stem cells ameliorate silica‐induced pulmonary fibrosis by inhibition of inflammation and epithelial‐mesenchymal transition. JOURNAL OF CELLULAR AND MOLECULAR MEDICINE, 2021 (PubMed: 34076355) [IF=5.3]

Application: WB    Species: rat    Sample: lung

FIGURE 5|BMSCs blocked the activation of TGF-β/Smad pathway. (D) Western blot results of TGF-β1, Smad2, p-Smad2, Smad3, p-Smad3 and Smad7 protein expression levels. n = 3 rats per group.

5). Corilagin alleviates hypertrophic scars via inhibiting the transforming growth factor (TGF)-β/Smad signal pathway. LIFE SCIENCES, 2021 (PubMed: 33862115) [IF=5.2]

Application: WB    Species: Human    Sample: Hypertrophic scar tissue

Fig. 5. Corilagin inhibited the protein levels of TGF-β1, TGFβRI and blocked the phosphorylation of Smad2 and Smad3, as well as affect the protein levels of MMPs and TIMPs. A. Western blot results showed the protein levels of TGF-β1, TGFβRI, and TGFβRII in HSFs incubated with corilagin for 3 days, GAPDH served as control. n = 3. B. Protein levels of phosphorylated and total Smad2 and Smad3 examined by western blot assay after HSFs were treated with corilagin for 3 days. GAPDH served as control. n = 3. C. Immunofluorescence staining of Smad2/3 in HSFs after treating with corilagin (0 μM) + TGF-β1 (0 ng/mL), corilagin (0 μM) + TGF-β1 (5 ng/mL) and corilagin (25 μM) + TGF-β1 (5 ng/mL) for 12 h. Smad2/3 is shown by green fluorescence and nuclei were stained with DAPI, which emits blue fluorescence. Scale bars = 50 μm. D. Protein levels of Smad7 examined by western blot assay after HSFs were treated with corilagin for 3 days. GAPDH served as control. n = 3. E. Protein levels of MMP2, MMP9, MMP13 and TIMP1 in HSFs after treatment with corilagin for 3 days. GAPDH served as control. n = 3. Data are show as mean ± SD. *p < 0.05, **p < 0.01, ***p < 0.001. (For interpretation of the references to color in this figure legend, the reader is referred to the web version of this article.)

Application: WB    Species: human    Sample: HSFs

Fig. 5. |Corilagin inhibited the protein levels of TGF-β1, TGFβRI and blocked the phosphorylation of Smad2 and Smad3, as well as affect the protein levels of MMPs and TIMPs. D. Protein levels of Smad7 examined by western blot assay after HSFs were treated with corilagin for 3 days. GAPDH served as control. n = 3.

6). Green tea peptides ameliorate diabetic nephropathy by inhibiting the TGF-β/Smad signaling pathway in mice. Food & Function, 2022 (PubMed: 35234233) [IF=5.1]

7). Molecular mechanism of Gan-song Yin inhibiting the proliferation of renal tubular epithelial cells by regulating miR-21-5p in adipocyte exosomes. Journal of ethnopharmacology, 2024 (PubMed: 38043753) [IF=4.8]

Application: WB    Species: Mouse    Sample: TCMK-1 cells

Fig. 4. Mechanism of GSY on TCMK-1. A. Viability of TCMK-1 cells treated with different concentrations of GSY. B. TCMK-1 cell viability in each experimental group. C. Changes in TCMK-1 cell cycle level after GSY intervention. D. Changes in apoptosis level of TCMK-1 cells after GSY intervention. E. Expression of TGF-β1, SMAD2, SMAD3, SMAD7, p-SMAD2, p-SMAD3 and p-SMAD7 proteins in TCMK-1 cells after GSY intervention. F. Gene expression levels of TGF-β1, SMAD2, SMAD3 and SMAD7 in TCMK-1 cells after GSY intervention. *p < 0.05; **p < 0.01; ***p < 0.001. NC: Negative control; MOD: Model (60 mmol/L glucose). All experiments were repeated three times.

8). Astilbin Alleviates Radiation-Induced Pulmonary Fibrosis via circ PRKCE Targeting the TGF-β/Smad7 Pathway to Inhibit Epithelial-Mesenchymal Transition. Biomedicines, 2025 (PubMed: 40149664) [IF=4.7]

9). SIRT1 activation ameliorates rhesus monkey liver fibrosis by inhibiting the TGF-β/smad signaling pathway. Chemico-biological interactions, 2024 (PubMed: 38555046) [IF=4.7]

10). miR‐448‐3p alleviates diabetic vascular dysfunction by inhibiting endothelial–mesenchymal transition through DPP‐4 dysregulation. JOURNAL OF CELLULAR PHYSIOLOGY, 2020 (PubMed: 32542696) [IF=4.5]

Application: WB    Species: Human    Sample: aortic endothelial cells

FIGURE 3 High glucose treatment reduced miR‐448‐3p expression, increased DPP‐4 expression, activated TGF‐β/Smad pathway, and promoted EndMT in aortic endothelial cells. (a) Relative mRNA expression levels of miR‐448‐3p and DPP‐4 in high glucose‐treated aortic endothelial cells. (b) The protein levels of DPP‐4, CD31, VE‐cadherin, α‐SMA, and vimentin in each group. (c) Relative protein levels of TGF‐β1, Smad2, p‐Smad2 (S465/S467), Smad3, p‐Smad3 (S423/S425), and Smad7 in all the groups. Data were expressed as means ± standard deviation (SD), n = 3. *p < .05 compared with the OC group. DPP‐4, dipeptidyl peptidase‐4; EndMT, endothelial–mesenchymal transition; HG, high glucose; miR, microRNA; mRNA, messenger RNA; TGF‐β, transforming growth factor‐β; α‐SMA, α‐smooth muscle actin

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.