Product: SOD2/MnSOD Antibody
Catalog: AF5144
Description: Rabbit polyclonal antibody to SOD2/MnSOD
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Xenopus
Mol.Wt.: 25 kDa; 25kD(Calculated).
Uniprot: P04179
RRID: AB_2837630

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
SOD2/MnSOD Antibody detects endogenous levels of total SOD2/MnSOD.
RRID:
AB_2837630
Cite Format: Affinity Biosciences Cat# AF5144, RRID:AB_2837630.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Indophenoloxidase B; IPO B; IPOB; Manganese containing superoxide dismutase; Manganese SOD; Manganese superoxide dismutase; Mangano superoxide dismutase; Mn SOD; Mn superoxide dismutase; MNSOD; MVCD6; SOD 2; SOD2; SODM_HUMAN; Superoxide dismutase [Mn] mitochondrial; Superoxide dismutase [Mn], mitochondrial; Superoxide dismutase 2 mitochondrial;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Mn SOD antibody Mn superoxide dismutase antibody MNSOD antibody MVCD6 antibody SOD 2 antibody SOD2 antibody SODM_HUMAN antibody
Sequence:
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Xenopus
100
Zebrafish
100
Rabbit
100
Dog
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P04179 As Substrate

Site PTM Type Enzyme
K53 Acetylation
Y58 Phosphorylation
K68 Acetylation
T79 Phosphorylation
S106 Phosphorylation P06493 (CDK1) , P11802 (CDK4)
K122 Acetylation
K122 Ubiquitination
S127 Phosphorylation
K130 Acetylation
K130 Methylation
K130 Ubiquitination
K132 Acetylation
K221 Acetylation

Research Backgrounds

Function:

Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.

PTMs:

Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.

Acetylation at Lys-122 decreases enzymatic activity. Deacetylated by SIRT3 upon exposure to ionizing radiations or after long fasting (By similarity).

Polyubiquitinated; leading to proteasomal degradation. Deubiquitinated by USP36 which increases protein stability.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homotetramer.

Family&Domains:

Belongs to the iron/manganese superoxide dismutase family.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Organismal Systems > Aging > Longevity regulating pathway.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway - multiple species.   (View pathway)

References

1). Resveratrol and its derivative pterostilbene attenuate oxidative stress-induced intestinal injury by improving mitochondrial redox homeostasis and function via SIRT1 signaling. Free radical biology & medicine, 2021 (PubMed: 34648904) [IF=7.4]

2). Procyanidin B2 regulates the Sirt1/Nrf2 signaling pathway to improve random-pattern skin flap survival. Phytotherapy Research, 2023 (PubMed: 37128130) [IF=7.2]

3). Resveratrol delays polycystic kidney disease progression through attenuation of nuclear factor κB-induced inflammation. NEPHROLOGY DIALYSIS TRANSPLANTATION, 2016 (PubMed: 27190325) [IF=6.1]

Application: WB    Species: rat    Sample:

FIGURE 3: Pro-inflammatory factors, anti-oxidant enzyme and cell signaling pathways in resveratrol (Res)- or vehicle-treated cystic kidneys. (A) TNF-α, MCP-1, CFB and SOD2 were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. (B–E) Immunohistochemical staining for oxidative stress markers 8-OHdG and nitrotyrosine in the tubulointerstitial area. Computer-assisted morphometry was used to quantify changes of 8-OHdG and nitrotyrosine in each group. Scale bar = 50 µm. (F) NF-κB pathway ( p-p65, p65, p105 and p50) and mTOR pathway ( p-S6K and total S6K) were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. Blots are representative of three independent experiments.

4). 3-MCPD Induced Mitochondrial Damage of Renal Cells Via the Rhythmic Protein BMAL1 Targeting SIRT3/SOD2. Journal of Agricultural and Food Chemistry, 2023 (PubMed: 37750480) [IF=6.1]

5). Drug D, a Diosgenin Derive, Inhibits L-Arginine-Induced Acute Pancreatitis through Meditating GSDMD in the Endoplasmic Reticulum via the TXNIP/HIF-1α Pathway. Nutrients, 2022 (PubMed: 35807771) [IF=5.9]

6). IR-61 improves voiding function via mitochondrial protection in diabetic rats. Frontiers in Pharmacology, 2021 (PubMed: 33935703) [IF=5.6]

Application: WB    Species: Rat    Sample: bladder tissues

FIGURE 6 IR-61 activated Nrf2 and increased antioxidant-related protein levels. (A–G) Western blot analysis of Nrf2, Keap1, HO-1, GPX-1, SOD-1, and SOD-2 in bladder tissue and quantitative analysis. Data indicate the mean ± SD (*p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 vs. control group, #p < 0.05, p < 0.01, ###p < 0.001, ####p < 0.0001 vs. DBD group).

7). Formononetin improves the survival of random skin flaps through PI3K/Akt-mediated Nrf2 antioxidant defense system. Frontiers in Pharmacology, 2022 (PubMed: 35662691) [IF=5.6]

Application: IHC    Species: Mice    Sample: skin flap tissue

FIGURE 7 (A,B) Western blot along with its quantification revealed that the level of P-PI3K, P-Akt and Nrf2 as treated above (C,D) Western blot along with its quantification revealed that the level of HO-1, NQO1, GCLc, GCLm and TrxR1 (E,F) The IHC result of SOD2 and HO-1 expression in skin flaps (scale bar: 50 μm) **p ≤ 0.01 compared to the control group; ##p ≤ 0.01 compared to the FMNT-H group.

8). Gastroprotective mechanism of modified lvdou gancao decoction on ethanol-induced gastric lesions in mice: Involvement of Nrf-2/HO-1/NF-κB signaling pathway. Frontiers in Pharmacology, 2022 (PubMed: 36120337) [IF=5.6]

Application: WB    Species: Mouse    Sample: gastric tissues

FIGURE 7 Effect of MLG on some protein levels in ethanol-induced gastric lesions mice. Some representative western blot bands (A). Protein levels of SOD1/GAPDH (B), SOD2/GAPDH (C), iNOS/GAPDH (D), nNOS/GAPDH (E), eNOS/GAPDH (F), COX2/GAPDH (G), p38/GAPDH (H) in mice gastric tissues. SOD1, Superoxide dismutase one or Cu/Zn-superoxide dismutase; SOD2/Mn SOD, superoxide dismutase 2. Control: the group administered zero ethanol; Model: the group administered ethanol intragastrically (13.25 ml/kg BW); MLG-L: low-dose (5 g/kg body weight) MLG-treated group; MLG-M: medium-dose (10 g/kg body weight) MLG-treated group; MLG-H: high-dose (20 g/kg body weight) MLG-treated group; CBP: the group receiving Colloid Bismuth Pectin (57 mg/kg body weight). Each group’s data was expressed as mean ± standard deviation (SD), n = 6. By one-way analysis of variance (ANOVA) test, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 vs. each group. Whole page of western blot can be found in Supplementary Figures S1, S3, S7, S8, S10, S14, S15, respectively.

9). The TβR II-targeted aptamer S58 prevents fibrosis after glaucoma filtration surgery. Aging-US, 2020 (PubMed: 32452828) [IF=5.2]

Application: WB    Species: human    Sample: HConFs

Figure 5. | S58 promotes antioxidant defense of TGF-β2-induced HConFs. (A) Analysis of antioxidant capacity of cells at day 14 after GFS. (B) Intracellular ROS variation, and (C) mitochondrial superoxide variation were examined by flow cytometry. (D) Antioxidant protein SOD1/2, γ-GCS and CAT levels analyzed by western blotting in TGF-β2-treated HConFs in the presence or absence of S58 (20 nM). (E) Relative antioxidant gene levels in HConFs preconditioned with TGF-β2 in the presence or absence of S58 (20 nM) for 12h. All data indicate the mean ± SD, n=3. *p < 0.05, **p < 0.01, ***p < 0.001.

10). Carnitine palmitoyltransferase 1 (CPT1) alleviates oxidative stress and apoptosis of hippocampal neuron in response to beta-Amyloid peptide fragment Aβ25-35. Bioengineered, 2021 (PubMed: 34424821) [IF=4.9]

Application: WB    Species: Mice    Sample: Aβ25-35-induced HT22 cells

Figure 3. CPT1C overexpression attenuated oxidative stress in Aβ25-35-induced HT22 cells. Following transfection of Ov-CPT1C or Ov-NC for 24 h, HT22 cells were treated with Aβ25–35 for another 24 h (a) ROS expression was detected using ROS kits. (b) MDA levels and SOD activity were measured using MDA and SOD kits, respectively. (c) The relative mRNA and protein expression of SOD1 and SOD2 in A25-35-induced HT22 cells were measured using RT-qPCR and western blot, respectively. ***P < 0.001 vs. Control group, ##P < 0.01 and ###P < 0.001 vs A25-35 + Ov-NC.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.