CD8 Antibody - #AF5126

(14)   (10)  
Product: CD8 Antibody
Catalog: AF5126
Description: Rabbit polyclonal antibody to CD8
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25 kDa; 26kD(Calculated).
Uniprot: P01732
RRID: AB_2837612

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CD8 Antibody detects endogenous levels of total CD8.
RRID:
AB_2837612
Cite Format: Affinity Biosciences Cat# AF5126, RRID:AB_2837612.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

alpha polypeptide (p32); CD8; CD8 antigen alpha polypeptide; CD8 antigen alpha polypeptide (p32); CD8a; CD8A antigen; CD8A molecule; CD8A_HUMAN; Leu2; Leu2 T lymphocyte antigen; Ly3; LYT3; MAL; OKT8 T cell antigen; OTTHUMP00000160760; OTTHUMP00000160764; OTTHUMP00000203528; OTTHUMP00000203721; p32; T cell antigen Leu2; T cell co receptor; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T cell antigen; T8/Leu-2 T-lymphocyte differentiation antigen;

Immunogens

Immunogen:
Uniprot:

P01732(CD8A_HUMAN) >>Visit HPA database.

Gene(ID):
CD8A(925)
Expression:
P01732 CD8A_HUMAN:

CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homodimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.

Description:
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Sequence:
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

PTMs - P01732 As Substrate

Site PTM Type Enzyme
S224 Phosphorylation
S229 Phosphorylation
S231 Phosphorylation

Research Backgrounds

Function:

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.

PTMs:

Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts.

O-glycosylated.

Phosphorylated in cytotoxic T-lymphocytes (CTLs) following activation.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.
Note: CD8A localizes to lipid rafts only when associated with its partner CD8B.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homodimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.

Subunit Structure:

Forms disulfide-linked heterodimers with CD8B at the cell surface. Forms also homodimers in several cell types including NK-cells or peripheral blood T-lymphocytes. Interacts with the MHC class I HLA-A/B2M dimer. One HLA-A molecule (mainly via nonpolymorphic alpha-3 domain) interacts with one CD8A homodimer (via CDR-like loop). Interacts with LCK in a zinc-dependent manner. Interacts with HLA-G; this interaction is direct and might down-regulate T cell receptor signaling.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Immune diseases > Primary immunodeficiency.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

References

1). Tumor cells impair immunological synapse formation via central nervous system-enriched metabolite. Cancer cell, 2024 (PubMed: 38821061) [IF=50.3]
2). Multifunctional 3D-printed scaffolds eradiate orthotopic osteosarcoma and promote osteogenesis via microwave thermo-chemotherapy combined with immunotherapy. Biomaterials, 2023 (PubMed: 37506512) [IF=14.0]
3). Alantolactone-loaded chitosan/hyaluronic acid nanoparticles suppress psoriasis by deactivating STAT3 pathway and restricting immune cell recruitment. Asian Journal of Pharmaceutical Sciences, 2022 (PubMed: 35582636) [IF=10.2]

Application: IF/ICC    Species: mouse    Sample: skin

Fig. 8| CHALT attenuates splenomegaly and immune cell recruitment in IMQ-induced skin. On Day 7, (A) the spleens were collected and photographed, and (B) the weight ratio of spleen/body was calculated. Immunfluorescence staining of (C) CD 4 and (E) CD 8 in the skin, and the relative amount of (D) CD 4 and (F) CD 8 was quantified (the normal group as the control).
4). SIRPα antibody combined with oncolytic virus OH2 protects against tumours by activating innate immunity and reprogramming the tumour immune microenvironment. BMC Medicine, 2022 (PubMed: 36310169) [IF=9.3]

Application: IHC    Species: Mouse    Sample:

Fig. 5M-IHC and IHC staining of the anti-SIRPα antibody treatment model. A Representative M-IHC results of the OH2 combined anti-SIRPα antibody group, OH2 combined isotype, OH2 group, and control group with larger tumour volume sat the initial treatment. CD8, green, CD16, sky blue, F4/80, purple, CD86, orange, and CD206, red. Scale bar, 100μm. B Quantitative results of NK cell (CD16) staining in the OH2 combined anti-SIRPα antibody group, OH2 combined isotype, OH2 group, and control group. n=3 samples/group. C Quantitative result of M2 macrophage (F4/80+CD206+) staining in the OH2 combined anti-SIRPα antibody group, OH2 combined isotype, OH2 group, and control group. n=3 samples/group. D Quantitative results of M1 macrophage (F4/80+CD86+) staining in the OH2 combined anti-SIRPα antibody group, OH2 combined isotype, OH2 group, and control group. n=3 samples/group. E Quantitative results of CD8 T cell staining in the OH2 combined anti-SIRPα antibody group, OH2 combined Isotype, OH2 group, and control group. n=3 samples/group. F Representative IHC staining for CD8, CD16, F4/80, CD86, and CD206 of the OH2 combined anti-SIRPα antibody group, OH2 combined isotype group, OH2 group, and control group with larger tumour volumes at the initial treatment. Original magnification, ×200. n=5 samples/group. G Quantitative results of CD8, CD16, F4/80, CD86 and CD206 staining in the OH2 combined anti-SIRPα antibody group, OH2 combined isotype, OH2 group and control group. n=5 samples/group. Statistical analysis was performed using ANOVA with multiple comparisons. ns, no significant differences, *, p<0.05, **, p<0.01, ***, p<0.001, ****, p<0.0001 (proportion represented the percentage of the cell to the total number of cells)
5). Icariside II attenuates cerebral ischemia/reperfusion-induced blood–brain barrier dysfunction in rats via regulating the balance of MMP9/TIMP1. Acta Pharmacologica Sinica, 2020 (PubMed: 32488170) [IF=8.2]
6). Machine-Learning Algorithm-Based Prediction of Diagnostic Gene Biomarkers Related to Immune Infiltration in Patients With Chronic Obstructive Pulmonary Disease. Frontiers in Immunology, 2022 (PubMed: 35350787) [IF=7.3]

Application: IHC    Species: mouse    Sample: lung

FIGURE 8 | Immune cell infiltration in COPD mouse models.(J) Representative immunohistochemistry images of CD8a and CD57 (400x).
7). CD147 monoclonal antibody attenuates abdominal aortic aneurysm formation in angiotensin II-Infused apoE-/- mice. International immunopharmacology, 2023 (PubMed: 37393837) [IF=5.6]
8). PD-1-Positive Tumor-Associated Macrophages Define Poor Clinical Outcomes in Patients With Muscle Invasive Bladder Cancer Through Potential CD68/PD-1 Complex Interactions. Frontiers in Oncology, 2021 (PubMed: 34079767) [IF=4.7]
9). ASPM Is a Prognostic Biomarker and Correlates With Immune Infiltration in Kidney Renal Clear Cell Carcinoma and Liver Hepatocellular Carcinoma. Frontiers in Oncology, 2022 (PubMed: 35515103) [IF=4.7]

Application: IHC    Species: Human    Sample: KIRC and LIHC tissues

Figure 7 Expression analysis of ASPM in KIRC and LIHC tissues. (A) Relative level of ASPM mRNA using quantitative RT-PCR; **p < 0.01. (B) The expression of ASPM was analyzed by Western-blot analysis using a compound samples. (C) Tumor infiltration of B cells, CD8+ T cells, and M2 macrophages in KIRC and LIHC using immunohistochemistry. 20 diagnosed cases of KIRC and 20 diagnosed cases of LIHC samples for immunohistochemistry. We validate the relationship between ASPM expression and B cells (marker: CD19), CD8+ T cells (marker: CD8A), and M2 macrophages (marker: CD163), we performed immunohistochemistry to assess ASPM, CD19, CD8A, and CD163. Muscle and lymph nodes as control samples. (a-d, f-i) Tumor infiltration of B cells, CD8+ T cells, and M2 macrophages in KIRC. (k-n, p-s) Tumor infiltration of B cells, CD8+ T cells, and M2 macrophages in LIHC. (a-d) High expression of ASPM (+++), CD8A (++), CD19 (++), and CD163 (++) in KIRC. (f-i) Low expression of ASPM (+), CD8A (+), CD19 (+), and CD163 (+) in KIRC. (k-n) High expression of ASPM (+++), CD8A (++), CD19 (++), and CD163 (++) in LIHC. (p-s) Low expression of ASPM (+), CD8A (+), CD19 (+), and CD163 (+) in LIHC. (e, o) lymph nodes was used as a positive control in KIRC (+++) and LIHC (+++). (j, t) muscle was used as a negative control in KIRC (-) and LIHC (-). The expression density of ASPM, CD8A, CD19, and CD163 in KIRC and LIHC tissues were quantitated by scoring staining intensity, including negative (–) and weak (+) staining, moderate (++) and strong (+ + +) staining, respectively.
10). CircPAN3 contributes to drug resistance in acute myeloid leukemia through regulation of autophagy. LEUKEMIA RESEARCH, 2019 (PubMed: 31401408) [IF=2.7]
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.