CD8 Antibody - #AF5126

Product: | CD8 Antibody |
Catalog: | AF5126 |
Description: | Rabbit polyclonal antibody to CD8 |
Application: | WB IHC |
Cited expt.: | WB, IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 25 kDa; 26kD(Calculated). |
Uniprot: | P01732 |
RRID: | AB_2837612 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5126, RRID:AB_2837612.
Fold/Unfold
alpha polypeptide (p32); CD8; CD8 antigen alpha polypeptide; CD8 antigen alpha polypeptide (p32); CD8a; CD8A antigen; CD8A molecule; CD8A_HUMAN; Leu2; Leu2 T lymphocyte antigen; Ly3; LYT3; MAL; OKT8 T cell antigen; OTTHUMP00000160760; OTTHUMP00000160764; OTTHUMP00000203528; OTTHUMP00000203721; p32; T cell antigen Leu2; T cell co receptor; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T cell antigen; T8/Leu-2 T-lymphocyte differentiation antigen;
Immunogens
A synthesized peptide derived from human CD8, corresponding to a region within the internal amino acids.
CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homodimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.
- P01732 CD8A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Research Backgrounds
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.
Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts.
O-glycosylated.
Phosphorylated in cytotoxic T-lymphocytes (CTLs) following activation.
Cell membrane>Single-pass type I membrane protein.
Note: CD8A localizes to lipid rafts only when associated with its partner CD8B.
Secreted.
CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homodimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Immune diseases > Primary immunodeficiency.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
References
Application: IF/ICC Species: mouse Sample: skin
Application: IHC Species: Mouse Sample:
Application: IHC Species: mouse Sample: lung
Application: IHC Species: Human Sample: KIRC and LIHC tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.