LYVE1 Antibody - #AF4202

Product: | LYVE1 Antibody |
Catalog: | AF4202 |
Description: | Rabbit polyclonal antibody to LYVE1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat, Monkey |
Mol.Wt.: | 40 kd; 35kD(Calculated). |
Uniprot: | Q9Y5Y7 |
RRID: | AB_2837586 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4202, RRID:AB_2837586.
Fold/Unfold
Cell surface retention sequence-binding protein 1; CRSBP 1; CRSBP-1; CRSBP1; extracellular link domain containing 1; extracellular link domain-containing 1; Extracellular link domain-containing protein 1; HAR; Hyaluronic acid receptor; Lymphatic endothelium specific hyaluronan receptor; lymphatic vessel endothelial hyaluronan receptor 1; Lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE 1; LYVE-1; LYVE1; LYVE1_HUMAN; XLKD1;
Immunogens
- Q9Y5Y7 LYVE1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV
PTMs - Q9Y5Y7 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T42 | Phosphorylation | Uniprot | |
N53 | N-Glycosylation | Uniprot | |
S67 | Phosphorylation | Uniprot | |
T76 | Phosphorylation | Uniprot | |
T146 | Phosphorylation | Uniprot | |
T280 | Phosphorylation | Uniprot | |
S297 | Phosphorylation | Uniprot | |
K298 | Methylation | Uniprot |
Research Backgrounds
Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as a hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.
O-glycosylated.
Membrane>Single-pass type I membrane protein.
Note: Localized to the plasma membrane and in vesicles near extranuclear membranes which may represent trans-Golgi network (TGN) and endosomes/prelysosomeal compartments. Undergoes ligand-dependent internalization and recycling at the cell surface.
Mainly expressed in endothelial cells lining lymphatic vessels.
Homodimer; disulfide-linked. Interacts with PDGFB and IGFBP3. Forms a transient ternary complex with PDGFB and PDGFRB in TGN (By similarity).
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.