TAS2R7 Antibody - #DF5166
| Product: | TAS2R7 Antibody |
| Catalog: | DF5166 |
| Description: | Rabbit polyclonal antibody to TAS2R7 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Rabbit, Dog |
| Mol.Wt.: | 36 KD; 37kD(Calculated). |
| Uniprot: | Q9NYW3 |
| RRID: | AB_2837515 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5166, RRID:AB_2837515.
Fold/Unfold
MGC142121; mT2R42; STC7 4; T2R30; T2R6; T2R7; TA2R7_HUMAN; Tas2r130; Tas2r6; TAS2R7; Taste receptor family B member 4; Taste receptor type 2 member 7; TRB4;
Immunogens
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
- Q9NYW3 TA2R7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLCVILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFLWMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISFLLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVIWKVMSILKGRKFQQHKQI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NYW3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S50 | Phosphorylation | Uniprot | |
| S54 | Phosphorylation | Uniprot | |
| T166 | Phosphorylation | Uniprot | |
| T169 | Phosphorylation | Uniprot | |
| S171 | Phosphorylation | Uniprot | |
| S296 | Phosphorylation | Uniprot | |
| S305 | Phosphorylation | Uniprot |
Research Backgrounds
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Membrane>Multi-pass membrane protein.
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
Belongs to the G-protein coupled receptor T2R family.
Research Fields
· Organismal Systems > Sensory system > Taste transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.