OR4F4 Antibody - #DF5093
| Product: | OR4F4 Antibody |
| Catalog: | DF5093 |
| Description: | Rabbit polyclonal antibody to OR4F4 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 30 KD; 34kD(Calculated). |
| Uniprot: | Q96R69 |
| RRID: | AB_2837452 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5093, RRID:AB_2837452.
Fold/Unfold
HS14a-1-A; OLA-7501; Olfactory receptor 4F4; Olfactory receptor family 4 subfamily F member 18; Olfactory receptor family 4 subfamily F member 4; Olfactory receptor OR19-3; OR4F17; OR4F18; OR4F4; OR4F4_HUMAN;
Immunogens
A synthesized peptide derived from human OR4F4, corresponding to a region within C-terminal amino acids.
- Q96R69 OR4F4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVVLLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAHSSVKF
Research Backgrounds
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.