OR1S1/1S2 Antibody - #DF5063
| Product: | OR1S1/1S2 Antibody |
| Catalog: | DF5063 |
| Description: | Rabbit polyclonal antibody to OR1S1/1S2 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 33 KD; 37kD(Calculated). |
| Uniprot: | Q8NGQ3 | Q8NH92 |
| RRID: | AB_2837422 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5063, RRID:AB_2837422.
Fold/Unfold
Olfactory receptor 1S1; Olfactory receptor 1S2; olfactory receptor, family 1, subfamily S, member 1; olfactory receptor, family 1, subfamily S, member 2; OR11 231; OR11 232; OST034; Olfactory receptor 1S1; Olfactory receptor 1S2; olfactory receptor, family 1, subfamily S, member 1; olfactory receptor, family 1, subfamily S, member 2; OR11 231; OR11 232; OST034;
Immunogens
- Q8NGQ3 OR1S2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKTLCSFLQISRNMHQENQTTITEFILLGLSNQAEHQNLLFVLFLSMYVVTVVGNGLIIVAISLDIYLHTPMYLFLAYLSFADISSISNSVPKMLVNIQTNSQSISYESCITQMYFSIVFVVTDNLLLGTMAFDHFVAICHPLNYTTFMRARFGTLLTVISWFLSNIIALTHTLLLIQLLFCDHNTLPHFFCDLAPLLKLSCSDTMINELVLFIVGLSVIIFPFVLIFFSYVCIIRAVLGVSSTQGKWKAFSTCGSHLTIALLFYGTTVGVYFFPSSTHPEDTDKIGAVLFTVVTPMMNPFIYSLRNKDMKGALRKLINRKISSL
- Q8NH92 OR1S1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKTFSSFLQIGRNMHQGNQTTITEFILLGFFKQDEHQNLLFVLFLGMYLVTVIGNGLIIVAISLDTYLHTPMYLFLANLSFADISSISNSVPKMLVNIQTKSQSISYESCITQMYFSIVFVVIDNLLLGTMAYDHFVAICHPLNYTILMRPRFGILLTVISWFLSNIIALTHTLLLIQLLFCNHNTLPHFFCDLAPLLKLSCSDTLINELVLFIVGLSVIIFPFTLSFFSYVCIIRAVLRVSSTQGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKISSL
PTMs - Q8NGQ3/Q8NH92 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S85 | Phosphorylation | Uniprot | |
| S86 | Phosphorylation | Uniprot | |
| S88 | Phosphorylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S85 | Phosphorylation | Uniprot | |
| S86 | Phosphorylation | Uniprot | |
| S88 | Phosphorylation | Uniprot |
Research Backgrounds
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.