EDNRA Antibody - #DF4923
Product: | EDNRA Antibody |
Catalog: | DF4923 |
Description: | Rabbit polyclonal antibody to EDNRA |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 48 KD; 49kD(Calculated). |
Uniprot: | P25101 |
RRID: | AB_2837276 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4923, RRID:AB_2837276.
Fold/Unfold
Ednra; EDNRA_HUMAN; Endothelin 1 receptor precursor; Endothelin 1 specific receptor; Endothelin A receptor; Endothelin ET A receptor; Endothelin receptor ET1 specific type; Endothelin receptor subtype A; Endothelin receptor type A; Endothelin-1 receptor; ET A; ET-A; ETA; ETA R; ETA-R; ETAR; ETRA; G protein coupled receptor; hET AR; hET-AR; MFDA;
Immunogens
Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.
- P25101 EDNRA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P25101 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y184 | Phosphorylation | Uniprot | |
Y263 | Phosphorylation | Uniprot | |
Y275 | Phosphorylation | Uniprot | |
S289 | Phosphorylation | Uniprot | |
S295 | Phosphorylation | Uniprot | |
Y333 | Phosphorylation | Uniprot | |
K338 | Acetylation | Uniprot | |
S382 | Phosphorylation | Uniprot | |
Y389 | Phosphorylation | Uniprot | |
S391 | Phosphorylation | Uniprot | |
S393 | Phosphorylation | Uniprot | |
T396 | Phosphorylation | Uniprot | |
S397 | Phosphorylation | Uniprot | |
T403 | Phosphorylation | Uniprot | |
S404 | Phosphorylation | Uniprot | |
T417 | Phosphorylation | Uniprot | |
S420 | Phosphorylation | Uniprot | |
S421 | Phosphorylation | Uniprot | |
S425 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Cell membrane>Multi-pass membrane protein.
Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.
Interacts with HDAC7 and KAT5.
Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Endocrine system > Renin secretion.
References
Application: IHC Species: Rat Sample:
Application: WB Species: Rat Sample:
Application: IHC Species: Human Sample: STAD tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.