Product: EDNRA Antibody
Catalog: DF4923
Description: Rabbit polyclonal antibody to EDNRA
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 48 KD; 49kD(Calculated).
Uniprot: P25101
RRID: AB_2837276

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(92%), Bovine(92%), Horse(92%), Sheep(92%), Rabbit(92%), Dog(92%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
EDNRA Antibody detects endogenous levels of total EDNRA.
RRID:
AB_2837276
Cite Format: Affinity Biosciences Cat# DF4923, RRID:AB_2837276.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Ednra; EDNRA_HUMAN; Endothelin 1 receptor precursor; Endothelin 1 specific receptor; Endothelin A receptor; Endothelin ET A receptor; Endothelin receptor ET1 specific type; Endothelin receptor subtype A; Endothelin receptor type A; Endothelin-1 receptor; ET A; ET-A; ETA; ETA R; ETA-R; ETAR; ETRA; G protein coupled receptor; hET AR; hET-AR; MFDA;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P25101 EDNRA_HUMAN:

Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.

Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Chicken
100
Pig
92
Horse
92
Bovine
92
Sheep
92
Dog
92
Rabbit
92
Xenopus
64
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P25101 As Substrate

Site PTM Type Enzyme
Y184 Phosphorylation
Y263 Phosphorylation
Y275 Phosphorylation
S289 Phosphorylation
S295 Phosphorylation
Y333 Phosphorylation
K338 Acetylation
S382 Phosphorylation
Y389 Phosphorylation
S391 Phosphorylation
S393 Phosphorylation
T396 Phosphorylation
S397 Phosphorylation
T403 Phosphorylation
S404 Phosphorylation
T417 Phosphorylation
S420 Phosphorylation
S421 Phosphorylation
S425 Phosphorylation

Research Backgrounds

Function:

Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.

Subunit Structure:

Interacts with HDAC7 and KAT5.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.

Research Fields

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Endocrine system > Renin secretion.

References

1). Deleterious effect in endothelin receptor–mediated coronary artery smooth muscle contractility in high-salt diet rats. Nutrition, Metabolism and Cardiovascular Diseases, 2023 (PubMed: 36404239) [IF=3.9]

Application: IHC    Species: Rat    Sample:

Figure 4Expression levels of ETA, ETB, STIM1, Orai1 in coronary arteries derived from 4% high-salt diet rats vs. controls. Western blot images (A–D) and summary data (E–H) of endothelial receptors ETA and ETB as well as of STIM1 and Orai1 in fresh isolated coronary arteries derived from rats fed a regular diet (control) and rats fed a high-salt diet. Protein expression levels were normalized to β-tubulin. Immunostaining results of ETA, ETB in segments of coronary arteries derived from control (I (a–b)) and high-salt diet (I (d–e)) rats (three rats in each group). The values are shown as mean ± SEM; n = 3–7 rats. ∗P < 0.05, ∗∗P < 0.01 compared with controls.

Application: WB    Species: Rat    Sample:

Figure 4Expression levels of ETA, ETB, STIM1, Orai1 in coronary arteries derived from 4% high-salt diet rats vs. controls. Western blot images (A–D) and summary data (E–H) of endothelial receptors ETA and ETB as well as of STIM1 and Orai1 in fresh isolated coronary arteries derived from rats fed a regular diet (control) and rats fed a high-salt diet. Protein expression levels were normalized to β-tubulin. Immunostaining results of ETA, ETB in segments of coronary arteries derived from control (I (a–b)) and high-salt diet (I (d–e)) rats (three rats in each group). The values are shown as mean ± SEM; n = 3–7 rats. ∗P < 0.05, ∗∗P < 0.01 compared with controls.

2). Comprehensive analysis of expression signature and immune microenvironment signature of biomarker Endothelin Receptor Type A in stomach adenocarcinoma. Journal of Cancer, 2023 (PubMed: 35517422) [IF=3.9]

Application: IHC    Species: Human    Sample: STAD tissue

Figure 3 The preliminary immunohistochemistry analysis and clinical analysis of EDNRA in STAD. (A) Representative Immunohistochemistry image of EDNRA and subcellular staining localization in STAD and adjacent non-tumor tissue specimens. (B) The expression of EDNRA in STAD tissue was higher than adjacent non-tumor tissue (P

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.