CCKAR Antibody - #DF4914
![](/images/pubmed.gif)
Product: | CCKAR Antibody |
Catalog: | DF4914 |
Description: | Rabbit polyclonal antibody to CCKAR |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Horse, Rabbit |
Mol.Wt.: | 44 KD; 48kD(Calculated). |
Uniprot: | P32238 |
RRID: | AB_2837267 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4914, RRID:AB_2837267.
Fold/Unfold
CCK A; CCK A receptor; CCK AR; CCK-A receptor; CCK1 R; CCK1-R; CCK1R; CCKA; CCKA receptor; CCKR Type A; CCKRA; Cholecystokinin 1 receptor; Cholecystokinin A receptor; Cholecystokinin receptor type A; Cholecystokinin type A receptor;
Immunogens
- P32238 CCKAR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P32238 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y263 | Phosphorylation | Uniprot | |
K308 | Acetylation | Uniprot | |
K309 | Acetylation | Uniprot |
Research Backgrounds
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)
· Organismal Systems > Digestive system > Pancreatic secretion.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.