Product: PTGER2 Antibody
Catalog: DF4878
Description: Rabbit polyclonal antibody to PTGER2
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 40 KD(Observed); 40kD(Calculated).
Uniprot: P43116
RRID: AB_2837241

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(83%), Bovine(92%), Sheep(92%), Rabbit(100%), Dog(92%)
Clonality:
Polyclonal
Specificity:
PTGER2 Antibody detects endogenous levels of total PTGER2.
RRID:
AB_2837241
Cite Format: Affinity Biosciences Cat# DF4878, RRID:AB_2837241.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EP2; PE2R2_HUMAN; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostaglandin E receptor 2 EP2 subtype; Prostaglandin E receptor 2 subtype EP2 53kDa; Prostaglandin E receptor 2 subtype EP2; Prostaglandin E2 receptor; Prostaglandin E2 receptor EP2 subtype; Prostanoid EP2 receptor; Ptger2;

Immunogens

Immunogen:

A synthesized peptide derived from human PTGER2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P43116 PE2R2_HUMAN:

Placenta and lung.

Sequence:
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Bovine
92
Sheep
92
Dog
92
Pig
83
Horse
67
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Placenta and lung.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.   (View pathway)

· Organismal Systems > Endocrine system > Renin secretion.

References

1). PGE2 inhibits neutrophil phagocytosis through the EP2R–cAMP–PTEN pathway. Immunity, Inflammation and Disease, 2022 (PubMed: 35759236) [IF=3.2]

Application: WB    Species: Human    Sample: HL-60 cells

Figure 2 PGE2 binding to EP2 receptors increases cAMP production in neutrophils. (A) HL-60 cells were pretreated with EP2R blocking antibody (1 μg/ml) or isotype control antibody (1 μg/ml) for 6 h, and then stimulated with PGE2 (1 μg/ml) for 12 h. The cells were collected and the cAMP content was determined by ELISA. *p 

2). Allopregnanolone relieves paclitaxel induced mechanical hypersensitivity via inhibiting spinal cord PGE2-EP2 mediated microglia-neuron signaling. IBRO neuroscience reports, 2025 (PubMed: 39911135) [IF=2.0]

Application: WB    Species: Rat    Sample:

Fig. 3. PTX treatment upregulates prostaglandin E2 (PGE2) level and increases the expression of the PGE2 receptor E-prostanoid 2 (EP2) in the spinal dorsal horn. We established CINP rat model with 4 alternate i.p. injections of PTX 2 mg/kg. Control rats received an equal volume of DMSO. ELISA examined the level of PGE2 in the dorsal spinal cord after PTX treatment. In addition, western blot and double immunofluorescence staining detected the expression and cellular distribution of EP2 in the spinal dorsal horn. (A) Quantification of PGE2 expression in the dorsal spinal cord in control and CINP rats using ELISA. Comparing with control rats, the release of PGE2 in CINP rats was significantly increased. Data were represented mean ± SEM. *P<0.05 compared with control rats. n = 6 rats for each group. (B) Quantification of EP2 expression in the dorsal spinal cord in control and CINP rats using western blot. It showed a significant increase in EP2 expression in CINP rats compared to control rats. Data were represented mean ± SEM. *P<0.05 compared with control rats. n = 6 rats for each group. (C) EP2 expression in the spinal dorsal horn was double-stained with cell-specific markers: NeuN, Iba-1, and GFAP, respectively, at day 14 after PTX treatment. As shown, EP2 was colocalized with NeuN but not Iba-1 or GFAP, indicating that the EP2 expression upregulation was happened in neurons. Scale bar = 50μm.

Application: IF/ICC    Species: Rat    Sample:

Fig. 3. PTX treatment upregulates prostaglandin E2 (PGE2) level and increases the expression of the PGE2 receptor E-prostanoid 2 (EP2) in the spinal dorsal horn. We established CINP rat model with 4 alternate i.p. injections of PTX 2 mg/kg. Control rats received an equal volume of DMSO. ELISA examined the level of PGE2 in the dorsal spinal cord after PTX treatment. In addition, western blot and double immunofluorescence staining detected the expression and cellular distribution of EP2 in the spinal dorsal horn. (A) Quantification of PGE2 expression in the dorsal spinal cord in control and CINP rats using ELISA. Comparing with control rats, the release of PGE2 in CINP rats was significantly increased. Data were represented mean ± SEM. *P<0.05 compared with control rats. n = 6 rats for each group. (B) Quantification of EP2 expression in the dorsal spinal cord in control and CINP rats using western blot. It showed a significant increase in EP2 expression in CINP rats compared to control rats. Data were represented mean ± SEM. *P<0.05 compared with control rats. n = 6 rats for each group. (C) EP2 expression in the spinal dorsal horn was double-stained with cell-specific markers: NeuN, Iba-1, and GFAP, respectively, at day 14 after PTX treatment. As shown, EP2 was colocalized with NeuN but not Iba-1 or GFAP, indicating that the EP2 expression upregulation was happened in neurons. Scale bar = 50μm.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.