ADORA2A Antibody - #DF4850

(1)   (2)  
Product: ADORA2A Antibody
Catalog: DF4850
Description: Rabbit polyclonal antibody to ADORA2A
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 37 KD; 45kD(Calculated).
Uniprot: P29274
RRID: AB_2837214

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
ADORA2A Antibody detects endogenous levels of total ADORA2A.
RRID:
AB_2837214
Cite Format: Affinity Biosciences Cat# DF4850, RRID:AB_2837214.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

A2AAR; A2aR; AA2AR_HUMAN; ADENO; Adenosine A2 receptor; Adenosine A2a receptor; Adenosine receptor A2a; Adenosine receptor subtype A2a; ADORA 2; ADORA2; ADORA2A; hA2aR; RDC 8; RDC8;

Immunogens

Immunogen:
Uniprot:

P29274(AA2AR_HUMAN) >>Visit HPA database.

Gene(ID):
ADORA2A(135)
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

PTMs - P29274 As Substrate

Site PTM Type Enzyme
S374 Phosphorylation

Research Backgrounds

Function:

Receptor for adenosine (By similarity). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).

PTMs:

Ubiquitinated. Deubiquitinated by USP4; leading to stabilization and expression at the cell surface.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.
Note: Colocalizes with GAS2L2 at neuronal processes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts (via cytoplasmic C-terminal domain) with USP4; the interaction is direct. May interact with DRD4. Interacts with NECAB2. Interacts (via cytoplasmic C-terminal domain) with GAS2L2; interaction enhances receptor-mediated adenylyl cyclase activity (By similarity).

Family&Domains:

The cytoplasmic C-terminal domain is necessary for targeting the non-ubiquitinated form of this protein to the cell surface.

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Substance dependence > Alcoholism.

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

References

1). Electroacupuncture improves neuronal plasticity through the A2AR/cAMP/PKA signaling pathway in SNL rats. Neurochemistry International, 2021 (PubMed: 33577869) [IF=4.2]

Application: WB    Species: rat    Sample: spinal dorsal horn

Fig. 7. EA upregulated the expression of A2AR, cAMP, PKA and p-CREB in the spinal dorsal horn after SNL, while SCH58261 had the opposite effects. (A), (C), (D), (E) Representative Western blots and quantification data of the expression of A2AR/GAPDH, PKA/GAPDH and p-CREB/CREB in each group. n = 5. (B) The content of cAMP in the spinal dorsal horn measured by ELISA. n = 6. (F), (G) qPCR showing the expression of A2AR and PKA mRNA in the spinal cord. n = 6. (H) Immunofluorescence of A2AR-, cAMP- and PKA-positive cells in the spinal dorsal horn. Scale bars, 200 μm. (I), (J), (K) Number of A2AR-, cAMP- and PKA-positive cells in the spinal dorsal horn (lamina I-II and lamina III-IV). n = 4. Columns represent the mean ± SD. $$p < 0.01 vs. the S group; ##p < 0.01 vs. the M group; &&p < 0.01 vs. the M + EA group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.