5HT5A receptor Antibody - #DF4848
| Product: | 5HT5A receptor Antibody |
| Catalog: | DF4848 |
| Description: | Rabbit polyclonal antibody to 5HT5A receptor |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Rabbit |
| Mol.Wt.: | 36 KD; 40kD(Calculated). |
| Uniprot: | P47898 |
| RRID: | AB_2837212 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4848, RRID:AB_2837212.
Fold/Unfold
HTR5A; 5 HT 5A; 5 hydroxytryptamine 5A receptor; 5-HT-5; 5-HT-5A; 5-HT5A; 5-hydroxytryptamine receptor 5A; 5HT5A; 5HT5A_HUMAN; HTR5A; Serotonin receptor 5A;
Immunogens
- P47898 5HT5A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P47898 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T260 | Phosphorylation | Uniprot | |
| Y345 | Phosphorylation | Uniprot | |
| S347 | Phosphorylation | Uniprot | |
| S354 | Phosphorylation | Uniprot |
Research Backgrounds
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Nervous system > Serotonergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.