CSF2RA Antibody - #DF4820
| Product: | CSF2RA Antibody |
| Catalog: | DF4820 |
| Description: | Rabbit polyclonal antibody to CSF2RA |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Mouse |
| Mol.Wt.: | 46 KD; 46kD(Calculated). |
| Uniprot: | P15509 |
| RRID: | AB_2837185 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4820, RRID:AB_2837185.
Fold/Unfold
CD_antigen=CD116; CD116; CD116 antigen; CDw116; Colony stimulating factor 2 receptor alpha chain; Colony stimulating factor 2 receptor alpha low affinity; Colony stimulating factor 2 receptor alpha subunit; CSF 2R; CSF2R; CSF2R_HUMAN; CSF2RA; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM CSF R alpha; GM CSF receptor alpha subunit; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR-alpha; Granulocyte macrophage colony stimulating factor receptor alpha chain; Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; SMDP4;
Immunogens
- P15509 CSF2R_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15509 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S34 | Phosphorylation | Uniprot | |
| S48 | Phosphorylation | Uniprot | |
| T55 | Phosphorylation | Uniprot | |
| T56 | Phosphorylation | Uniprot | |
| K158 | Ubiquitination | Uniprot | |
| S222 | Phosphorylation | Uniprot | |
| T225 | Phosphorylation | Uniprot | |
| N229 | N-Glycosylation | Uniprot | |
| K365 | Ubiquitination | Uniprot | |
| K387 | Ubiquitination | Uniprot | |
| T395 | Phosphorylation | Uniprot | |
| K397 | Ubiquitination | Uniprot |
Research Backgrounds
Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
Cell membrane>Single-pass type I membrane protein.
Secreted.
Secreted.
Secreted.
Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors. The signaling GM-CSF receptor complex is a dodecamer of two head-to-head hexamers of two alpha, two beta, and two ligand subunits.
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Belongs to the type I cytokine receptor family. Type 5 subfamily.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.