GPR100 Antibody - #DF4888
| Product: | GPR100 Antibody |
| Catalog: | DF4888 |
| Description: | Rabbit polyclonal antibody to GPR100 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Sheep |
| Mol.Wt.: | 38 KD; 41kD(Calculated). |
| Uniprot: | Q8TDU9 |
| RRID: | AB_2837180 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4888, RRID:AB_2837180.
Fold/Unfold
G protein coupled receptor 100; G-protein coupled receptor 100; G-protein coupled receptor GPCR142; GPCR142; Insulin-like peptide INSL5 receptor; Relaxin 3 receptor 2; Relaxin family peptide receptor 4; Relaxin-3 receptor 2; Relaxin/insulin like family peptide receptor 4; RL3R2_HUMAN; RLN3 receptor 2; RLN3R2; Rxfp4; RXFPR4;
Immunogens
Expressed in a broader range of tissues including brain, kidney, testis, thymus, placenta, prostate, salivary gland, thyroid and colon.
- Q8TDU9 RL3R2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8TDU9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T78 | Phosphorylation | Uniprot | |
| T119 | Phosphorylation | Uniprot | |
| Y126 | Phosphorylation | Uniprot | |
| T133 | Phosphorylation | Uniprot | |
| S362 | Phosphorylation | Uniprot |
Research Backgrounds
High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation.
Cell membrane>Multi-pass membrane protein.
Expressed in a broader range of tissues including brain, kidney, testis, thymus, placenta, prostate, salivary gland, thyroid and colon.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.