IL21 Antibody - #DF4818
| Product: | IL21 Antibody |
| Catalog: | DF4818 |
| Description: | Rabbit polyclonal antibody to IL21 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 18 KD; 19kD(Calculated). |
| Uniprot: | Q9HBE4 |
| RRID: | AB_2837169 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4818, RRID:AB_2837169.
Fold/Unfold
CVID11; IL 21; IL-21; Il21; IL21_HUMAN; Interleukin 21; Interleukin-21; interleukin-21 isoform; Interleukin21; OTTHUMP00000164088; Za11;
Immunogens
Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
- Q9HBE4 IL21_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9HBE4 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S109 | Phosphorylation | Uniprot | |
| T110 | Phosphorylation | Uniprot |
Research Backgrounds
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
Secreted.
Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
Belongs to the IL-15/IL-21 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.