Product: KLRK1 Antibody
Catalog: DF4816
Description: Rabbit polyclonal antibody to KLRK1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Mol.Wt.: 25 KD(Observed); 25kD(Calculated).
Uniprot: P26718
RRID: AB_2837167

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Polyclonal
Specificity:
KLRK1 Antibody detects endogenous levels of total KLRK1.
RRID:
AB_2837167
Cite Format: Affinity Biosciences Cat# DF4816, RRID:AB_2837167.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD314; CD314 antigen; D12S2489E; Killer cell lectin like receptor subfamily K member 1; Killer cell lectin-like receptor subfamily K member 1; KLR; KLRC4 KLRK1 readthrough; KLRK1; NK cell receptor D; NK lectin-like receptor; NKG2 D activating NK receptor; NKG2 D type II integral membrane protein; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; Nkg2d; NKG2D_HUMAN; NKLLR; NKR P2; Nkrp2;

Immunogens

Immunogen:

A synthesized peptide derived from human KLRK1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P26718 NKG2D_HUMAN:

Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs).

Sequence:
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Research Backgrounds

Function:

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein.
Note: Colocalized with HCST on the cell surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs).

Research Fields

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

References

1). CircARAP2 controls sMICA-induced NK cell desensitization by erasing CTCF/PRC2-induced suppression in early endosome marker RAB5A. Cellular and molecular life sciences : CMLS, 2024 (PubMed: 39048814) [IF=6.2]

Application: WB    Species: Human    Sample: NK cell

Fig. 1 CircARAP2 is upregulated in sMICA-induced NK cell desensitization. A The workflow of profiling circRNAs associated with sMICA-induced NK cell desensitization. B Flow cytometry and RT-qPCR analysis of NKG2D expression on NK92 and human primary activated NK cells treated with rsMICA for 24 h. n = 3 for NK92 cells, n = 8 for activated NK cells; Unpaired two-tailed t-test for RT-qPCR analysis, paired two-tailed t-test for flow cytometry analysis. C Left panel, Representative IF image of NKG2D and RAB5 on NK92 (Scale bar, 20 μm) and human primary activated NK (Scale bar, 10 μm) cells treated with rsMICA; Right panel, Quantification of Pearson coefficient of colocalization in pairs NKG2D/RAB5 on NK92 and human primary activated NK cells following rsMICA treatment (Repeats = 3, unpaired two-tailed t-test). D Immunoblot of NKG2D in both NK92 and human primary activated NK cells treated with rsMICA. Data represent three independent experiments, unpaired two-tailed t-test. E The calcein-AM release assay was used to assess the cytotoxicity of NK92 and human primary activated NK cells following rsMICA treatment. Data are presented of three independent experiments, two-way ANOVA. F Flow cytometry was used to assess the IFN-γ, Granzyme B and CD107a expression in both NK92 and human primary activated NK cells treated with rsMICA. Data are presented of three independent experiments, paired two-tailed t-test. G Flow cytometry was used to assess the expression of inhibitory receptors TIGIT and CD96 in NK92 and human primary activated NK cells with rsMICA treatment. Data are presented of three independent experiments, paired two-tailed t-test. H Volcano plot showing differentially expressed circRNAs in NK92 samples with or without rsMICA treatment (Left panel). KEGG analysis showing enrichment of differentially expressed circRNAs in the endocytosis pathway (Middle panel). Heatmap showing changes in expression levels of circRNAs enriched in the endocytosis pathway (Right panel). I Expression of circARAP2 and linear ARAP2 in both NK92 (n = 3) and primary activated NK cells (n = 10) after treatment with rsMICA. Unpaired two-tailed t-test was used for the comparison of two groups. (ns no significance, *P 

2). NLRP3 promotes NK cell-mediated cytotoxicity and inhibits colorectal cancer development via the NKG2D signaling pathway. Journal of molecular histology, 2025 (PubMed: 40844640) [IF=2.9]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.