Product: THY1 Antibody
Catalog: DF4804
Description: Rabbit polyclonal antibody to THY1
Application: WB IHC IF/ICC
Cited expt.: IHC, IF/ICC
Reactivity: Human, Rat
Prediction: Horse, Rabbit, Dog
Mol.Wt.: 28 KD; 18kD(Calculated).
Uniprot: P04216
RRID: AB_2837158

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Prediction:
Horse(80%), Rabbit(80%), Dog(90%)
Clonality:
Polyclonal
Specificity:
THY1 Antibody detects endogenous levels of total THY1.
RRID:
AB_2837158
Cite Format: Affinity Biosciences Cat# DF4804, RRID:AB_2837158.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD7; CD90; CD90 antigen; CDw90; FLJ33325; MGC128895; T25; Theta antigen; Thy 1; Thy 1 cell surface antigen; Thy 1 membrane glycoprotein; Thy 1 T cell antigen; Thy 1.2; Thy-1 antigen; Thy-1 membrane glycoprotein; Thy1; Thy1 antigen; Thy1 T cell antigen; Thy1.1; Thy1.2; THY1_HUMAN; Thymus cell antigen 1, theta;

Immunogens

Immunogen:

A synthesized peptide derived from human THY1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
90
Horse
80
Rabbit
80
Pig
70
Bovine
70
Sheep
70
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Subcellular Location:

Cell membrane>Lipid-anchor.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

References

1). Intranasal delivery of engineered extracellular vesicles loaded with miR-206-3p antagomir ameliorates Alzheimer's disease phenotypes. Theranostics, 2024 (PubMed: 39659569) [IF=12.4]

2). ZIF-8 Modified Multifunctional Bone-Adhesive Hydrogels Promoting Angiogenesis and Osteogenesis for Bone Regeneration. ACS Applied Materials & Interfaces, 2020 (PubMed: 32814397) [IF=8.3]

3). EphrinB2 overexpression enhances osteogenic differentiation of dental pulp stem cells partially through ephrinB2-mediated reverse signaling. Stem Cell Research & Therapy, 2020 (PubMed: 31996240) [IF=7.5]

Application: IF/ICC    Species: canine    Sample: cDPSCs

Fig. 5 Culture, characterization, and transfection of cDPSCs and proliferation of cDPSCs in PuraMatrix. a Cell colonies stained with crystal violet. b, c Verification of osteogenic, adipogenic, and neurogenic differentiation capabilities of cDPSCs. Scale bar of left and right images, 100 μm; scale bar of middle images, 50 μm. *p < 0.05 and **p < 0.01. d Stem cell markers of cDPSCs. Scale bar = 1 mm. e, f Verification of green fluorescence expression and ephrinB2 upregulation in transfected cDPSCs. Scale bar = 100 μm. **p < 0.01. g Alizarin Red S staining of cDPSCs, Vector-cDPSCs (ephrinB2 overexpression control), and EfnB2-cDPSCs (ephrinB2 overexpression) on day 24 of osteogenesis. h Alizarin Red S staining intensity was quantified with ImageJ. *p < 0.05. i Proliferation of cDPSCs (1 × 106 cells/ml) in 0.5%, 0.25%, and 0.125% PuraMatrix. *p < 0.05 and **p < 0.01 vs. 0.25% PuraMatrix; # p < 0.05 and ## p < 0.01 vs. 0.125% PuraMatrix. j Proliferation of cDPSCs at different cell densities (0.25, 0.5, 1, 2, or 4 × 106 cells/ml) in 0.25% PuraMatrix. Data are shown as mean ± SD. Assays were repeated three times

Application: IF/ICC    Species: beagles    Sample: cDPSCs

Fig. 5 | Culture, characterization, and transfection of cDPSCs and proliferation of cDPSCs in PuraMatrix. a Cell colonies stained with crystal violet. b,c Verification of osteogenic, adipogenic, and neurogenic differentiation capabilities of cDPSCs. Scale bar of left and right images, 100 μm; scale bar of middle images, 50 μm. *p < 0.05 and **p < 0.01. d Stem cell markers of cDPSCs. Scale bar = 1 mm.

4). Protective effect of bone morphogenetic protein-7 induced differentiation of bone marrow mesenchymal stem cells in rat with acute spinal cord injury. Functional & integrative genomics, 2023 (PubMed: 36849554) [IF=3.9]

5). Exploration of the optimal retention method in vivo for stem cell therapy: Low-intensity ultrasound preconditioning. Regenerative therapy, 2025 (PubMed: 40390863) [IF=3.4]

Application: IF/ICC    Species: Rat    Sample: BMSCs

Fig. 5. A. Fluorescent CD90 labelling of BMSCs and distribution in skin tissues in each group. B. Green fluorescence density of CD90 in each group. C. Comparison of serum SDF-1 levels in each group. D. The morphology of BMSCs after LIUS irradiation was observed under optical microscope (×40). ∗P < 0.05; ∗∗P < 0.01; ∗∗∗∗P < 0.0001.

6). Mechanisms of Erythropoietin-Mediated Protection Against Retinal Ganglion Cell Apoptosis. Medical science monitor : international medical journal of experimental and clinical research, 2025 (PubMed: 40341414) [IF=2.2]

Application: IHC    Species: Mouse    Sample: retinal tissues

Figure 1. Erythropoietin (EPO)-overexpressed (Ov-EPO) lentivirus indicated higher expressing efficacy. (A) RGCs were isolated and identified by immunohistochemical staining of the Thy-1 molecule. (B) EPO gene was cloned into the Ov-EPO lentivirus. (C) RGC cells infected with the Ov-EPO lentivirus showed higher transcription of the EPO gene according to the RT-qPCR assay (n=3) *** P

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.