Cytochrome P450 4A11/22 Antibody - #DF4749
Product: | Cytochrome P450 4A11/22 Antibody |
Catalog: | DF4749 |
Description: | Rabbit polyclonal antibody to Cytochrome P450 4A11/22 |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Bovine, Dog |
Mol.Wt.: | 60 KD; 59kD(Calculated). |
Uniprot: | Q02928 | Q5TCH4 |
RRID: | AB_2837103 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4749, RRID:AB_2837103.
Fold/Unfold
20-HETE synthase; 20-hydroxyeicosatetraenoic acid synthase; CP4AB_HUMAN; CYP4A; Cyp4a1; Cyp4a10; CYP4A11; Cyp4a14; Cyp4a3; CYP4A7; CYP4AII; CYPIVA11; Cytochrome P-450HK-omega; Cytochrome P450 4A1; Cytochrome P450 4A10; Cytochrome P450 4A11; Cytochrome P450 4A14; Cytochrome P450 4A2; Cytochrome P450 4A3; Cytochrome P450 4A7; Cytochrome P450HL-omega; Fatty acid omega-hydroxylase; Lauric acid omega-hydroxylase;
Immunogens
Expressed in liver (PubMed:7679927). Expressed in S2 and S3 segments of proximal tubules in cortex and outer medulla of kidney (PubMed:7679927, PubMed:10660572).
- Q02928 CP4AB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL
- Q5TCH4 CP4AM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPMARLVLKSKNGIHLRLRRLPNPCEDKDQL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q02928/Q5TCH4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S7 | Phosphorylation | Uniprot | |
S307 | Phosphorylation | Uniprot | |
S394 | Phosphorylation | Uniprot | |
T395 | Phosphorylation | Uniprot | |
T485 | Phosphorylation | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
S4 | Phosphorylation | Uniprot | |
S7 | Phosphorylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
Y88 | Phosphorylation | Uniprot | |
Y100 | Phosphorylation | Uniprot | |
Y104 | Phosphorylation | Uniprot | |
K106 | Acetylation | Uniprot | |
K115 | Acetylation | Uniprot | |
S307 | Phosphorylation | Uniprot | |
S394 | Phosphorylation | Uniprot | |
T395 | Phosphorylation | Uniprot |
Research Backgrounds
A cytochrome P450 monooxygenase involved in the metabolism of fatty acids and their oxygenated derivatives (oxylipins). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase). Catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of saturated and unsaturated fatty acids, the catalytic efficiency decreasing in the following order: dodecanoic > tetradecanoic > (9Z)-octadecenoic > (9Z,12Z)-octadecadienoic > hexadecanoic acid. Acts as a major omega-hydroxylase for dodecanoic (lauric) acid in liver. Participates in omega-hydroxylation of (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) to 20-hydroxyeicosatetraenoic acid (20-HETE), a signaling molecule acting both as vasoconstrictive and natriuretic with overall effect on arterial blood pressure. Can also catalyze the oxidation of the penultimate carbon (omega-1 oxidation) of fatty acids with lower efficiency. May contribute to the degradation of saturated very long-chain fatty acids (VLCFAs) such as docosanoic acid, by catalyzing successive omega-oxidations to the corresponding dicarboxylic acid, thereby initiating chain shortening. Omega-hydroxylates (9R,10S)-epoxy-octadecanoate stereoisomer. Plays a minor role in omega-oxidation of long-chain 3-hydroxy fatty acids. Has little activity toward prostaglandins A1 and E1.
Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.
Expressed in liver. Expressed in S2 and S3 segments of proximal tubules in cortex and outer medulla of kidney.
Belongs to the cytochrome P450 family.
Catalyzes the omega- and (omega-1)-hydroxylation of various fatty acids such as laurate and palmitate. Shows no activity towards arachidonic acid and prostaglandin A1. Lacks functional activity in the kidney and does not contribute to renal 20-hydroxyeicosatetraenoic acid (20-HETE) biosynthesis.
Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.
Belongs to the cytochrome P450 family.
Research Fields
· Metabolism > Lipid metabolism > Fatty acid degradation.
· Metabolism > Lipid metabolism > Arachidonic acid metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
References
Application: WB Species: Human Sample: HepG2 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.