MYL7 Antibody - #DF4730
Product: | MYL7 Antibody |
Catalog: | DF4730 |
Description: | Rabbit polyclonal antibody to MYL7 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Dog |
Mol.Wt.: | 18 KD; 19kD(Calculated). |
Uniprot: | Q01449 |
RRID: | AB_2837081 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4730, RRID:AB_2837081.
Fold/Unfold
zgc:92755; atrial isoform; cmlc2; MGC92755; MLC-2a; MLC2a; MLCK, cardiac; MLRA_HUMAN; MYL2A; MYL7; Mylc2a; Myosin light chain 2a; Myosin light chain 7 regulatory; Myosin light polypeptide 7 regulatory; Myosin regulatory light chain 2; Myosin regulatory light chain 2 atrial isoform; Myosin regulatory light chain 7;
Immunogens
- Q01449 MLRA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q01449 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S23 | Phosphorylation | Uniprot | |
K119 | Acetylation | Uniprot | |
Y165 | Phosphorylation | Uniprot |
Research Backgrounds
Predominantly expressed in adult atrial muscle.
Myosin is a hexamer of 2 heavy chains and 4 light chains.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.