MYL6 Antibody - #DF4718
Product: | MYL6 Antibody |
Catalog: | DF4718 |
Description: | Rabbit polyclonal antibody to MYL6 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 17 KD; 17kD(Calculated). |
Uniprot: | P60660 |
RRID: | AB_2837069 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4718, RRID:AB_2837069.
Fold/Unfold
adult 1; MYH1; MYH1_HUMAN; MYH2; MYH3; MYH4; MYH6; MyHC-2x; MyHC-IIx/d; MYL1; MYL2; MYL3; MYL5; MYL6; Myosin light chain 2 regulatory cardiac slow; Myosin 1; Myosin heavy chain 1; Myosin heavy chain 1 skeletal muscle adult; Myosin heavy chain 2 skeletal muscle adult; Myosin heavy chain 2x; Myosin heavy chain 3 skeletal muscle adult; Myosin heavy chain 4 skeletal muscle adult; Myosin heavy chain 6 skeletal muscle adult; Myosin heavy chain; Myosin heavy chain IIx/d; Myosin heavy chain skeletal muscle adult 1; Myosin II; Myosin light chain 1 alkali skeletal fast; Myosin light chain 3 alkali ventricular skeletal slow; Myosin light chain 4 alkali atrial embryonic; Myosin light chain 5 regulatory; Myosin light chain 6 alkali smooth muscle and non muscle; Myosin-1; Myosin1; skeletal muscle;
Immunogens
- P60660 MYL6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P60660 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
C2 | Acetylation | Uniprot | |
K13 | Ubiquitination | Uniprot | |
S20 | Phosphorylation | Uniprot | |
R21 | Methylation | Uniprot | |
T22 | Phosphorylation | Uniprot | |
K26 | Acetylation | Uniprot | |
K26 | Ubiquitination | Uniprot | |
Y29 | Phosphorylation | Uniprot | |
S30 | Phosphorylation | Uniprot | |
T44 | Phosphorylation | Uniprot | |
K50 | Acetylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
K56 | Sumoylation | Uniprot | |
K56 | Ubiquitination | Uniprot | |
S57 | Phosphorylation | Uniprot | |
K63 | Ubiquitination | Uniprot | |
K79 | Ubiquitination | Uniprot | |
K81 | Acetylation | Uniprot | |
K81 | Ubiquitination | Uniprot | |
T85 | Phosphorylation | Uniprot | |
Y86 | Phosphorylation | Uniprot | |
Y89 | Phosphorylation | Uniprot | |
R94 | Methylation | Uniprot | |
K98 | Acetylation | Uniprot | |
K98 | Ubiquitination | Uniprot | |
T103 | Phosphorylation | Uniprot | |
T115 | Phosphorylation | Uniprot | |
T121 | Phosphorylation | Uniprot | |
S135 | Phosphorylation | Uniprot | |
Y141 | Phosphorylation | Uniprot |
Research Backgrounds
Regulatory light chain of myosin. Does not bind calcium.
Myosin is a hexamer of 2 heavy chains and 4 light chains. Interacts with SPATA6.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.