STARD10 Antibody - #DF4691
| Product: | STARD10 Antibody |
| Catalog: | DF4691 |
| Description: | Rabbit polyclonal antibody to STARD10 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 33kDa; 33kD(Calculated). |
| Uniprot: | Q9Y365 |
| RRID: | AB_2837042 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4691, RRID:AB_2837042.
Fold/Unfold
Antigen NY-CO-28; CGI 52; MGC14401; NY CO 28; PCTL_HUMAN; PCTP-L; PCTP-like protein; PCTP2; SDCCAG28; Serologically defined colon cancer antigen 28; StAR related lipid transfer (START) domain containing 10; StAR-related lipid transfer protein 10; StARD10; START domain containing 10; START domain-containing protein 10;
Immunogens
- Q9Y365 STA10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y365 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| S7 | Phosphorylation | Uniprot | |
| S21 | Phosphorylation | Uniprot | |
| S97 | Phosphorylation | Uniprot | |
| Y143 | Phosphorylation | Uniprot | |
| Y148 | Phosphorylation | Uniprot | |
| Y155 | Phosphorylation | Uniprot | |
| S166 | Phosphorylation | Uniprot | |
| S203 | Phosphorylation | Uniprot | |
| S253 | Phosphorylation | Uniprot | |
| S259 | Phosphorylation | Uniprot | |
| S284 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| T288 | Phosphorylation | Uniprot | |
| S289 | Phosphorylation | Uniprot | |
| T291 | Phosphorylation | Uniprot |
Research Backgrounds
May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.
Phosphorylation at Ser-284 by CK2 negatively regulates lipid transfer activity, possibly by decreasing membrane association.
Cell projection>Cilium>Flagellum. Cytoplasm. Membrane.
Note: In testis was predominantly detected at the flagella of elongated spermatids, with a strong signal also found at the tail of epididymal sperm (By similarity). Mainly cytosolic.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.