TBPL2 Antibody - #DF4661
Product: | TBPL2 Antibody |
Catalog: | DF4661 |
Description: | Rabbit polyclonal antibody to TBPL2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Dog |
Mol.Wt.: | 41 KD; 42kD(Calculated). |
Uniprot: | Q6SJ96 |
RRID: | AB_2837012 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4661, RRID:AB_2837012.
Fold/Unfold
TATA binding protein 2; TATA box binding protein like 2; TATA box-binding protein-like 2; TATA box-binding protein-like protein 2; TATA box-binding protein-related factor 3; TATA-binding protein 2; TBP related factor 3; TBP-like protein 2; TBP-related factor 3; Tbpl2; TBPL2_HUMAN; TRF3;
Immunogens
Ubiquitously expressed in all tissues examined with highest levels in heart, lung, ovary, spleen and testes.
- Q6SJ96 TBPL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPLFSPVVPYDMYILNASNPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQDVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKKA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q6SJ96 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K262 | Ubiquitination | Uniprot | |
S267 | Phosphorylation | Uniprot | |
Y274 | Phosphorylation | Uniprot | |
S344 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor required in complex with TAF3 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process (By similarity).
Cytoplasm. Nucleus.
Note: Present in the cytoplasm during cytokinesis.
Ubiquitously expressed in all tissues examined with highest levels in heart, lung, ovary, spleen and testes.
Interacts with TAF3.
Belongs to the TBP family.
Research Fields
· Genetic Information Processing > Transcription > Basal transcription factors.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.