TAZ Antibody - #DF4653

Product: | TAZ Antibody |
Catalog: | DF4653 |
Description: | Rabbit polyclonal antibody to TAZ |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 43 KD, 53 kDa; 33kD(Calculated). |
Uniprot: | Q16635 |
RRID: | AB_2837004 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4653, RRID:AB_2837004.
Fold/Unfold
Barth syndrome; Cardiomyopathy dilated 3A (X linked); EFE2; Endocardial fibroelastosis 2; Protein G4.5; Tafazzin; TAZ; TAZ protein; TAZ_HUMAN;
Immunogens
High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal muscle. Some forms appear restricted to cardiac and skeletal muscle or to leukocytes.
- Q16635 TAZ_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
PTMs - Q16635 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K56 | Ubiquitination | Uniprot | |
K135 | Ubiquitination | Uniprot | |
K149 | Acetylation | Uniprot | |
K160 | Ubiquitination | Uniprot | |
K264 | Ubiquitination | Uniprot |
Research Backgrounds
Some isoforms may be involved in cardiolipin (CL) metabolism.
Membrane>Single-pass membrane protein.
Cytoplasm.
Membrane>Single-pass membrane protein.
Membrane>Single-pass membrane protein.
Membrane>Single-pass membrane protein.
Cytoplasm.
Membrane>Single-pass membrane protein.
Cytoplasm.
Cytoplasm.
High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal muscle. Some forms appear restricted to cardiac and skeletal muscle or to leukocytes.
The hydrophilic domain may serve as an exposed loop interacting with other proteins.
Belongs to the taffazin family.
Research Fields
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.