PSMD6 Antibody - #DF4652
| Product: | PSMD6 Antibody |
| Catalog: | DF4652 |
| Description: | Rabbit polyclonal antibody to PSMD6 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 45 KD; 46kD(Calculated). |
| Uniprot: | Q15008 |
| RRID: | AB_2837003 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4652, RRID:AB_2837003.
Fold/Unfold
26S proteasome non-ATPase regulatory subunit 6; 26S proteasome regulatory subunit RPN7; 26S proteasome regulatory subunit S10; Breast cancer-associated protein SGA-113M; KIAA0107; p42A; P44S10; PFAAP4; Phosphonoformate immuno-associated protein 4; Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6; Proteasome regulatory particle subunit p44S10; PSMD6; PSMD6_HUMAN; Rpn7; S10; SGA-113M;
Immunogens
- Q15008 PSMD6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15008 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K13 | Ubiquitination | Uniprot | |
| R18 | Methylation | Uniprot | |
| K82 | Ubiquitination | Uniprot | |
| K93 | Ubiquitination | Uniprot | |
| K107 | Ubiquitination | Uniprot | |
| K117 | Acetylation | Uniprot | |
| K117 | Ubiquitination | Uniprot | |
| K126 | Ubiquitination | Uniprot | |
| K130 | Ubiquitination | Uniprot | |
| K165 | Ubiquitination | Uniprot | |
| S166 | Phosphorylation | Uniprot | |
| K181 | Ubiquitination | Uniprot | |
| Y222 | Phosphorylation | Uniprot | |
| Y225 | Phosphorylation | Uniprot | |
| S227 | Phosphorylation | Uniprot | |
| K242 | Ubiquitination | Uniprot | |
| K284 | Ubiquitination | Uniprot | |
| K349 | Ubiquitination | Uniprot | |
| S361 | Phosphorylation | Uniprot | |
| K362 | Ubiquitination | Uniprot | |
| Y366 | Phosphorylation | Uniprot | |
| T369 | Phosphorylation | Uniprot | |
| K371 | Ubiquitination | Uniprot | |
| K372 | Ubiquitination | Uniprot | |
| R379 | Methylation | Uniprot |
Research Backgrounds
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.
Component of the 19S proteasome regulatory particle complex. The 26S proteasome consists of a 20S core particle (CP) and two 19S regulatory subunits (RP). The regulatory particle is made of a lid composed of 9 subunits including PSMD6, a base containing 6 ATPases and few additional components.
Belongs to the proteasome subunit S10 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Proteasome.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.