UBE2T Antibody - #DF4601
| Product: | UBE2T Antibody |
| Catalog: | DF4601 |
| Description: | Rabbit polyclonal antibody to UBE2T |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 22 KD; 23kD(Calculated). |
| Uniprot: | Q9NPD8 |
| RRID: | AB_2836965 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4601, RRID:AB_2836965.
Fold/Unfold
Cell proliferation inducing gene 50 protein; Cell proliferation-inducing gene 50 protein; HSPC150; HSPC150 protein similar to ubiquitin conjugating enzyme; PIG50; Ube2t; UBE2T_HUMAN; Ubiquitin carrier protein T; Ubiquitin conjugating enzyme; ubiquitin conjugating enzyme E2 T; Ubiquitin conjugating enzyme E2T; Ubiquitin protein ligase T; Ubiquitin-conjugating enzyme E2 T; Ubiquitin-protein ligase T;
Immunogens
A synthesized peptide derived from human UBE2T, corresponding to a region within the internal amino acids.
- Q9NPD8 UBE2T_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in mitomycin-C (MMC)-induced DNA repair. Acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. Also mediates monoubiquitination of FANCL and FANCI. May contribute to ubiquitination and degradation of BRCA1. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination.
Auto-ubiquitinated. Effects of auto-monoubiquitination at Lys-91 and Lys-182 are unclear: according to a report, monoubiquitination inactivates E2 enzyme activity. In contrast, according to another report, autoubiquitination does not affect E2 enzyme activity.
Nucleus.
Note: Accumulates to chromatin.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.